Conserved Protein Domain Family
BAR_FAM92

?
cd07598: BAR_FAM92 
The Bin/Amphiphysin/Rvs (BAR) domain of Family with sequence similarity 92 (FAM92)
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions including organelle biogenesis, membrane trafficking or remodeling, and cell division and migration. This group is composed of proteins from the family with sequence similarity 92 (FAM92), which were originally identified by the presence of the unknown domain DUF1208. This domain shows similarity to the BAR domains of sorting nexins. Mammals contain at least two member types, FAM92A and FAM92B, which may exist in many variants. The Xenopus homolog of FAM92A1, xVAP019, is essential for embryo survival and cell differentiation. FAM92A1 may be involved in regulating cell proliferation and apoptosis. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153282
View PSSM: cd07598
Aligned: 17 rows
Threshold Bit Score: 276.118
Threshold Setting Gi: 156401691
Created: 12-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   #  ##   # ##  ## ##  ## ##  ## ##  #                    #  ##        
Q1LU86        10 ARDTQTKQIQENITSVEKHFGDLCQLFAAYVRKTARLRDKADLLVKEINVYADTE--TPNLKCGLKNFADQLAKVQDYRQ 87  zebrafish
XP_002127863  14 EREAQSKFIEEAVQKVQKYFGLMCNEIGGICRKNGRLRDKYDDFAKTCMEYANVE--QGPLKTKLTNFSENISAIQDYRQ 91  Ciona intestinalis
XP_002160745  14 SGEQQTKVVTENIEKIENHFPQLVHDINLYTVRSAKLRDAGDNMAKSIRLYADSE--TSSIKQGLGALAECFASVQDQRN 91  green hydra
XP_395189     10 IWEQEAKFVQDRISNVEKHFAELCTTFAAYTRKAARLRDKGDEIAKIIQTYAESEtiNRSLSNGLTNFSTTLSVIGDYRD 89  honey bee
XP_967258     10 NCEQEAKFVQDRIVSVERTIGELCHVFGQYSRKAARLRDKGDEIAKVTLEHAEAEqlNRSLSLALENFADCISLLSSYGD 89  red flour beetle
XP_001633680   5 ATEHQTKVVDQNIATVEGHFPKIVSSLQRYAYGTAKLRDKGDELYKSIAAYAENE--APSMKEGLHVLAECLAAVQDYRD 82  starlet sea ane...
XP_553768     11 LCDEQTKFILERISTVEKHFGELCGAFAEYTRKVARMRDKTDELAHTTQDYCDTEklNPTLTGALSSMAKAVTLLGDFHD 90  Anopheles gambi...
XP_002115949  19 NRDAQFKFLSQRITRVEKHLAIINQRFQVLATKTGRLKLRSELVAKAVNDYADEE--SISIKNGLRGFVDCFLALQSHMQ 96  Trichoplax adha...
NP_609564     12 TKDDRVKIINERINITERHLMEMCSSFALVTRKMAKYRDSFDELAKSVKSYADDEeiNESLCQGLKSFTNAVTIMGDYMD 91  fruit fly
XP_002226270   9 AKENQMKFIQDRITKAEQHFGTLCQEFAGFSRKTAKLRDKGDELAKALLTYAEAE--GQSLKSGVTGFAETISAIQDYRQ 86  Florida lancelet
Feature 1                                                                                        
Q1LU86        88 AEVERLEVKVIEPLKAYGNIVKTKREDLKQTQSARNREAKQMQQLERMRQRNPSDRQiisqAESELQRATMDATRTTRQL 167 zebrafish
XP_002127863  92 AQIERIEGKVLTPLTTYGRECKHTQNDLNTSFKARNRELKQHQQVEALRNKSPHDRHtitqAEAELQRRTVDVARTTQTL 171 Ciona intestinalis
XP_002160745  92 ALVTRLEKKVFQTFAVYDTRCKQAKVDVKKHSLAHSKELIEHKSYERVKQRSVEHFQla-kAETKFKKASEEAHRSAQIL 170 green hydra
XP_395189     90 AQVQRFDAKIISSLSQYATICKNARDDVKNTFTARDKELTRKRHLDRLKERNPRNRQmisqAESELMKASVEVSRVVKGL 169 honey bee
XP_967258     90 LRVQNLDSKVIKEFARYEDICKHAKDEVKQIYNAREKEIARKRQLDRIKERNPRNRQqiiqAETELVKASAEFSKTLRNL 169 red flour beetle
XP_001633680  83 AEVHRIEENMVQKLSIYDTKCKQARNDVKNSSSLCSKEVKSFNSLEKIQTKSSDRSRia-rAQAEFQKASGEANRSLRVL 161 starlet sea ane...
XP_553768     91 ARVKRLEAKIVSELAQYETVCKHCKEDVKEALLVRDKDLAKRKQLEQSKSRNGRLKRn--tNDTEIIKSNLEVEKALKEI 168 Anopheles gambi...
XP_002115949  97 AHADHIENKVIEPFSRYSHTCRHMKEDLKNGFTARDKLLAKEKQLERIKGKEPANKSk--iLESDTSKIRDDAEKQTKSL 174 Trichoplax adha...
NP_609564     92 INVHRLEHKIVNELAQFEQLCKSTRDNLRLAVIARDKEVLRQRQMLELKSKFSANNSa---ADSELFKAKMEVQRTNKEI 168 fruit fly
XP_002226270  87 AEVQRLDAKVVQPLTLYGNTCKHAKEDLKKSQTARGKEQQQQQRLEKARQKNPSDRHt--iAESELQRAAVDATRSDRAL 164 Florida lancelet
Feature 1            #  ## #    #  ## ##  ##  ## ##  ## ##            
Q1LU86       168 EETIDDFEKQKIRDIKKVLGEFVTVEMAFHAKALEIYTTAYQHIQNVDEEGDL 220 zebrafish
XP_002127863 172 ANTIDKFETKKIQDLKKIFSEFVKVEMLFHAKALELYTNTYNALQTIDEEEHI 224 Ciona intestinalis
XP_002160745 171 EEQMDDFERKKIRDLKQVFGDFMLSEMLFYAKALEIYTLGYQELMSVDEDKSI 223 green hydra
XP_395189    170 EEQIDTFEKRKLHDLKTILLDFIIIELSFHAKTLELLTKGYHDIAGIDEVKDL 222 honey bee
XP_967258    170 EEKSTEFERQKLHDVKSILLDFVAIEMGYHARALEVLTNAYKAVNSMDEEADL 222 red flour beetle
XP_001633680 162 REQMNEFEMQKMKDIKTIFTDFIRCEMEVSARSLELYTRAFRSINGISVDEDI 214 starlet sea anemone
XP_553768    169 EHQVERFEKQKLHDLKELLLSFVLIELKMHTQAVEVLSATYQDISDIDESKDL 221 Anopheles gambiae str. PEST
XP_002115949 175 EEEMDNFEKEKIRDIKIVFGNYIHGAMHYHAKALEVLTLADQYIANINEEEDL 227 Trichoplax adhaerens
NP_609564    169 DDIIGNFEQRKLRDLKQIISDFILIAMKQHTKALEILSASYYDIGTIDERDDF 221 fruit fly
XP_002226270 165 EEQMDNFERQKMEDIKKILCDFVHVEMVFHCKALELYTVAHQYLQGINDEDDL 217 Florida lancelet

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap