2RAI,3DYU


Conserved Protein Domain Family
BAR_SNX

?
cd07596: BAR_SNX 
Click on image for an interactive view with Cn3D
The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153280
View PSSM: cd07596
Aligned: 44 rows
Threshold Bit Score: 107.057
Threshold Setting Gi: 162330107
Created: 1-May-2009
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interface
Conserved site includes 43 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Structure:2RAI_AB; interface between monomers of human SNX9 dimer; defined at 4A contacts.
    View structure with Cn3D
  • Structure:3DYU_AB; interface between monomers of human SNX9 dimer; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   #  ##   ## ##  #  ##  #       ## ##  #  ##  ##                     # 
2RAI_A       191 EIEQKCEAVGKFTKAXDD-GVKELLTVGQEHWKRCTGPLPkEYQKIGKALQSLATVFsssgyqgetdlnDAITEAGKTYE 269 human
3DYU_A       165 EIEQKCEAVGKFTKAMDD-GVKELLTVGQEHWKRCTGPLPkEYQKIGKALQSLATVFsssgyqgetdlnDAITEAGKTYE 243 human
NP_593047    238 DPCQALANLRPIVKSFYK-NAKDAEIKLEKLVNRKQSLAL-THADLGQSLIDYSVEEqhn------glaNALNRVGKMLQ 309 fission yeast
NP_001012625 300 ESDAWFEEKQQQFENLDQ-QLKKLHASVEALVCHRKELSA-NTAAFAKSAAMLGNSEdht------alsRALSQLAEVEE 371 chicken
XP_001876617 226 DEDEELQRARFELTKLEG-QFFETAKAVDKLALTRKTLAT-AHAEMGNKLINVATTEahp------plgNALRKIGRTWH 297 Laccaria bicolo...
XP_566931    258 DEDDELSSAKIALDKLEE-RYGHAATCVSHVGKARRQLAN-SNAELGAKMVGLSTVEsep------slaGAERKIGRAWE 329 Cryptococcus ne...
Q9UNH7       205 DVDDFFEHERTFLLEYHN-RVKDASAKSDRMTRSHKSAAD-DYNRIGSSLYALGTQDstd-------icKFFLKVSELFD 275 human
XP_001731236 135 DPDKRLSMARGEVTRLEK-QLGDVVSACTSVAKARQDVDR-AMEHVARKLPALAMLEetrpasmqgrlpHTLKSAHSMMN 212 Malassezia glob...
XP_446455    312 ENDEYLIKAFDRISIIEQ-QFKTLVTSLTLIDKERGELKS-VQLEYYKTLQGLADEElnk------hcsEVIRAFARNHQ 383 Candida glabrat...
NP_013004    361 EASTEIQACHDWVSISKEqWKQLLYHVLQYIVDEAVKVNS-VINEFTECLKQISLDEvir------ansELFLKFSKLNE 433 baker's yeast
Feature 1                                                                                        
2RAI_A       270 EIASLVAEQPKKDLHFLXECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVats------------------------- 324 human
3DYU_A       244 EIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVats------------------------- 298 human
NP_593047    310 AISDVRIMQSSKQLVTLADSLCYASDNAFVVKEILSNRHILMRDLISSKNQTnsylsaanrlqdspk---iskartddal 386 fission yeast
NP_001012625 372 KIDQLHQEQAFADFYMFSELLGDYIRLIAAVKGVFDHRMKCWQKWQDAQVTLqkkreaeaklqlan-----kpdklqqak 446 chicken
XP_001876617 298 SLADLDHAQSISECVILGDSLGYQGMNARSAKETLQMRTGVLEEYQAAVKTTiskrrqierlkassn---irpdrvdeal 374 Laccaria bicolo...
XP_566931    330 QVSGMINAQASNENVILSDTLGYQALNARAAKDTLVQRTAVLEDSQSASKAAitkrrnlerlkassn---inpakvddai 406 Cryptococcus ne...
Q9UNH7       276 KTRKIEARVSADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALdkarak---------------------n 334 human
XP_001731236 213 HVAQLSDQMMRADQVTLGDALEYEELNLRIARQTLQERMAIVVERTLAKRVVsnkqhdaehykfarh---qrpdrlesak 289 Malassezia glob...
XP_446455    384 QTVLFIDEDSVQEYENVWTSVDLFLRYCTSIRATLDQRVILGTYCLIVKTQLqkataalekln-----------ggsvfv 452 Candida glabrat...
NP_013004    434 SFLKKFKGASRQDILKLIILFDENVRFCESFESILNQRLKLGKILSIIEVDLdkkknfldklspgnnnsnnedlkirtae 513 baker's yeast
Feature 1                                    #  ## ###  #  ## ### ##  ## ##   ## ##  
2RAI_A       325 ---kiTLQDKQNXVKRVSIXSYALQAEXNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEK-LRQALSR 388 human
3DYU_A       299 ---kiTLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEK-LRQALSR 362 human
NP_593047    387 qalevARVHEKLLSDKVDFVTLNLVKESKTYTKKTSVSLQKAIREYVEKEAYYERRLLSI-MESIRPH 453 fission yeast
NP_001012625 447 deikeWESKVQQGEKDFEQISKTIRKEVGRFEKERVKDFKTVIIKYLESLVQTQQQLIKY-WEAFLPE 513 chicken
XP_001876617 375 edmeeANKYEQVLAKRAEGISQNLHQALQIHNRYANDDITTALIEHTRSSIMYERQLLRE-LESLRGD 441 Laccaria bicolor S238N-H82
XP_566931    407 semqeADSLEQSLSHRVTAISQNLHLSLRAHSRHAHEDIAISLMEAARMSAMYHKQTLRE-LESLRAD 473 Cryptococcus neoformans var...
Q9UNH7       335 kdvlqAETSQQLCCQKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQL-LQNCLAV 401 human
XP_001731236 290 eevqeAQQHMELLERYLSQVSESLNESLQRHSIHTHHDLQCTMQLHARTSRSLEKRIADM-LALFDSE 356 Malassezia globosa CBS 7966
XP_446455    453 frsvdKKEQLEKTIQILSRRKTKIEAEIESITTEIKKNLRNFYGFISKIFMKNTEKYVDAlLVTHNKQ 520 Candida glabrata CBS 138
NP_013004    514 deyriVLKRYNRVKQSWEKIMEDILNERKEFEKREAAEVNSCLKSIRDLNMDEKKHYLQL-WQDFVPD 580 baker's yeast

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap