Conserved Protein Domain Family
BAR_RhoGAP_Rich-like

?
cd07595: BAR_RhoGAP_Rich-like 
The Bin/Amphiphysin/Rvs (BAR) domain of Rich-like Rho GTPase Activating Proteins
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. This subfamily is composed of Rho and Rac GTPase activating proteins (GAPs) with similarity to GAP interacting with CIP4 homologs proteins (Rich). Members contain an N-terminal BAR domain, followed by a Rho GAP domain, and a C-terminal prolin-rich region. Vertebrates harbor at least three Rho GAPs in this subfamily including Rich1, Rich2, and SH3-domain binding protein 1 (SH3BP1). Rich1 and Rich2 play complementary roles in the establishment and maintenance of cell polarity. Rich1 is a Cdc42- and Rac-specific GAP that binds to polarity proteins through the scaffold protein angiomotin and plays a role in maintaining the integrity of tight junctions. Rich2 is a Rac GAP that interacts with CD317 and plays a role in actin cytoskeleton organization and the maintenance of microvilli in polarized epithelial cells. SH3BP1 is a Rac GAP that inhibits Rac-mediated platelet-derived growth factor (PDGF)-induced membrane ruffling. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions. The BAR domain of Rich1 has been shown to form oligomers, bind membranes and induce membrane tubulation.
Statistics
?
PSSM-Id: 153279
View PSSM: cd07595
Aligned: 13 rows
Threshold Bit Score: 239.93
Threshold Setting Gi: 24648294
Created: 1-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                #  ##         # ##  ## ##                                ## ##  ## ##  #
Q99N37        13 NQTVGRAEKTEVLSEDLLQ---IERRLDTVRSMCHhshkr-----liacfQGQHGTDAERRHKklPLTALAQNMQEASAQ 84  Norway rat
Q17R89        13 NQTVGRAEKTEVLSEDLLQ---VEKRLELVKQVSHsthkk-----ltaclQGQQGAEADKRSKklPLTTLAQCLMEGSAI 84  human
NP_061830     16 GSLGRTPETAEFLGEDLLQ---VEQRLEPAKRAAHnihkr-----lqaclQGQSGADMDKRVKklPLMALSTTMAESFKE 87  human
XP_001640058  13 DQKVGRAEKTEILSVDLQN---VEKTVDKIKTACQsaskr------isasMQGSGSDFERRLRklNQTGLANSMLESSNQ 83  starlet sea ane...
XP_002205631  13 NQTVGRAEKTEVLSDELLQ---IEKKIDNVKLATHnvtkk------lsacQQGGGDNLDKRMKklPQSALSQSMLESSSL 83  Florida lancelet
XP_002120731  13 DQKVGRANKSEVLNDEMLQ---VEKHMEHVRVACQstykk-----lsqclQTHSIGEYEKRIKrvSEHVLGQGMLDASKS 84  Ciona intestinalis
XP_001950332  13 DQTFSRSGKTEALSDTLQT---AEKRVEFIKNACQnttkkll-stlispgLGHDAPAREKRLKkmPDYLLAMAMLDNGPN 88  pea aphid
XP_969894     13 DQTFLRADKSEVLNNEELQv--ADQKIEYLRTALSaiik--------ripHSGQNNDIDKRIKksIEHHLASVFFEQSTR 82  red flour beetle
XP_001898880  20 QQSVGLSEKKDELQSVSHVeqrNQKIILAVKNTRQnlqn--------cirSVNREEAIDKRKRrlDEFGLWQQLLTDAKE 91  agent of lympha...
XP_001649194  29 PCSCGRSNKVEKNADGLQD---IEREVDRYKDILQnlnkria--ttvsagQPQDAVAKEKRVRkvAEFQLGQLMEDSVKD 103 yellow fever mo...
XP_002109180  12 ANQSIGRAEKTEISDKLQQ---IEKKSEAAKKSLStvvkv------fvpyINGTGVDKEKRLRknHASHLGQSLQDCTAN 82  Trichoplax adha...
NP_650844     12 AENLSRSSKSDSKDSELEA---IERQVDRYRDTIEkivrklpalsggggsGSGSSEEQDKRTKknSHYKIAQALDESAKE 88  fruit fly
XP_001746984  26 GKLADRQRKGGLLPEEDER---LEHEVFAVRDAYAta-----------lkRGQECHMTDDRKI--PVYGYGTRMKKAAEA 89  Monosiga brevic...
Feature 1                             #  ##                                                      
Q99N37        85 LEESllgk---------mleTCGDAENQLAFELSQHEVFVEKEIMDPLYGIAe----vEIPNIQKQRKQLARLVLDWDSV 151 Norway rat
Q17R89        85 LGDDtllg--------kmlkLCGETEDKLAQELIHFELQVERDVIEPLFLLAe----vEIPNIQKQRKHLAKLVLDMDSS 152 human
NP_061830     88 LDPDssmg--------kaleMSCAIQNQLARILAEFEMTLERDVLQPLSRLSe----eELPAILKHKKSLQKLVSDWNTL 155 human
XP_001640058  84 LGDMsllg--------mvlsQTGEAQLSIARSLCEFEMSVEKNVMIPMTTILe----nDIPNIYQAKKKLSKAALEMDTC 151 starlet sea ane...
XP_002205631  84 MGDEtllg--------tlfqLCGEGQGNLAKDLTNYEMEVEKTVMTPLTNLQe----vDIPAIQTQRKRLAKLVLDMDSA 151 Florida lancelet
XP_002120731  85 LLSEsdsnqt----lgsslrVCGEAQIGLAKEKAMYEMFVDEHVIAPLQTLVe----sEIPSIMKQRERLKKLVLDRDGA 156 Ciona intestinalis
XP_001950332  89 EEDNllrq---------vlvECSKVQICLANAGVDYESRIEQTVLSKLQQILd----vDVPNIIKQKRLLTKLVLDMDLA 155 pea aphid
XP_969894     83 KNEQgdlqelpndlfcatlkKCALVEQDLAREYADHEKQVEDLVSAPIQALLd----sDFHNILKQKRNLSKYILDKDSA 158 red flour beetle
XP_001898880  92 LENVyprsqps--vladtlkLYGDAMGVILEERVLTDQLIEKSVLDAFGKYMd-----DDKALSKAKEKLTRTVVDVEVS 164 agent of lympha...
XP_001649194 104 LPAGllrd---------vldRSARLEKTIASEIINNEMNIENSVSKNLNDIIe----rHLATIQKQKRTVSKCHQEYEAT 170 yellow fever mo...
XP_002109180  83 LPSDsvlk--------svvmDLGTALNEVGKLQVNAEANIDEDVVIPISNVL------ENDGAAKAKKRLSGARLDMDSA 148 Trichoplax adha...
NP_650844     89 LPKDmplq--------kvlaNCGELEKTMAECIIESELETEAKVVRRLKNILd----kEIQEISTLKRNVSRTLQEYTSL 156 fruit fly
XP_001746984  90 LDQTspff--------dmynKVAGVQEMLGLLTGDHHRKLHEQIYSTIDQTLreeypkAAKSTQRFGKHPQQVRPALDSL 161 Monosiga brevic...
Feature 1                                                                  #  ## #   #  ## ##  ##
Q99N37       152 RARWNQahkssgt-----------nfqglpSKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEgEYGKFFVTLLEAQA 220 Norway rat
Q17R89       153 RTRWQQtskssgls---------sslqpagAKADALREEMEEAANRVEICRDQLSADMYSFVAKEiDYANYFQTLIEVQA 223 human
NP_061830    156 KSRLSQatknsgssqglggspgshshttmaNKVETLKEEEEELKRKVEQCRDEYLADLYHFVTKEdSYANYFIRLLEIQA 235 human
XP_001640058 152 KSRYLAalktfqga--------skdpwgaqSKADALKEELENETAKFEACQDGFTTEALTFVAREaEFAEWMIKFIEAQQ 223 starlet sea ane...
XP_002205631 152 RSRYHSairssntg---------gnqaaamAKAESLKDEMDDAQSRMNLCRDALATDMYQFVSKEqEYAHNLISLVEAQI 222 Florida lancelet
XP_002120731 157 YQNWNKvhksqftp--------ganlqqitAKSEILKDEYDQAVIRMEQSKDQLVTDLFEFLAKEaGHGQRMSDFHAKQL 228 Ciona intestinalis
XP_001950332 156 RAKYQGvlknsn------------sgsshtNKVDAVKEELEDIELKVEQCKDSLASEIFQLISREaEISSVLMELIKHQR 223 pea aphid
XP_969894    159 SNRYHA------------------------TKKEALRDDMEEADYKVEQSRDALAYEMFSLLAKEnDLAGYMLQILKCQR 214 red flour beetle
XP_001898880 165 RKRKQGnh--------------------deSKAQEIQDEYDALQLKLESYKDNIFTDIFILLSREaEIAGIYKELITAQM 224 agent of lympha...
XP_001649194 171 RQKYDSavrnsd-------------qlgnqAKLTQLKDDQEELHNKLEKERDLYESYMYELLAEEeNIANYVKDYVKHQE 237 yellow fever mo...
XP_002109180 149 KSRLNKekerss-------------gsvnmVKLKTLNDEYENNEKIFNQAQDGLAIEHLQFLSNEtMVASSVLNFVDHQM 215 Trichoplax adha...
NP_650844    157 KRSHEAairl----------------eepaAKVNHIKSQQEECELKLEKERDAWAAQMLELIAKEdEIVSCIRDYVLNQR 220 fruit fly
XP_001746984 162 RRQNKEvn---------------------rPKVDALESDLHDAERALASQRAKYVEALVEVSAHErDFAIPLVNMILQQL 220 Monosiga brevic...
Feature 1          ## ##  ## ##                       
Q99N37       221 DYHRKALAVLEKALPEMRAHQDKWAEKPAFGTPLEEH 257 Norway rat
Q17R89       224 EYHRKSLTLLQAVLPQIKAQQEAWVEKPSFGKPLEEH 260 human
NP_061830    236 DYHRRSLSSLDTALAELRENHGQADHSPSMTATHFPR 272 human
XP_001640058 224 EYHKSASMILQDVLPLLKTQVESSSLRSVFGCPLEEH 260 starlet sea anemone
XP_002205631 223 RFHRAAISSLEKVLPAMKGQLEQAMMKPVYGLSLEEH 259 Florida lancelet
XP_002120731 229 DYHRRCVDLLEKMKPDMDSVQDNAVMKSAFGLSLSDH 265 Ciona intestinalis
XP_001950332 224 SYHQTALAVLNEIVPELETVIDSNPSKPVFGQKLEDH 260 pea aphid
XP_969894    215 AYHDSALKHLESVIPELEKQIGDSSVKRVYGISLQDH 251 red flour beetle
XP_001898880 225 EYHRTALQKLENILPEIDRKIASYPNRPVFGCHLEDH 261 agent of lymphatic filariasis
XP_001649194 238 MYYTSALREIQGTIKNMDGLFRRNNKKIFNTPLQEHL 274 yellow fever mosquito
XP_002109180 216 LYLKEAIAVYEAFRPSIQKSIEQSPRKKVFGVTLTEH 252 Trichoplax adhaerens
NP_650844    221 NYHERALQHVNASLARIQDTIQGTEKSRFGTSLKEHL 257 fruit fly
XP_001746984 221 EFHRTAVSMIESMLPKLQELQQQVGSNKAFGQPLPET 257 Monosiga brevicollis MX1

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap