Conserved Protein Domain Family

cd07595: BAR_RhoGAP_Rich-like 
The Bin/Amphiphysin/Rvs (BAR) domain of Rich-like Rho GTPase Activating Proteins
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. This subfamily is composed of Rho and Rac GTPase activating proteins (GAPs) with similarity to GAP interacting with CIP4 homologs proteins (Rich). Members contain an N-terminal BAR domain, followed by a Rho GAP domain, and a C-terminal prolin-rich region. Vertebrates harbor at least three Rho GAPs in this subfamily including Rich1, Rich2, and SH3-domain binding protein 1 (SH3BP1). Rich1 and Rich2 play complementary roles in the establishment and maintenance of cell polarity. Rich1 is a Cdc42- and Rac-specific GAP that binds to polarity proteins through the scaffold protein angiomotin and plays a role in maintaining the integrity of tight junctions. Rich2 is a Rac GAP that interacts with CD317 and plays a role in actin cytoskeleton organization and the maintenance of microvilli in polarized epithelial cells. SH3BP1 is a Rac GAP that inhibits Rac-mediated platelet-derived growth factor (PDGF)-induced membrane ruffling. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions. The BAR domain of Rich1 has been shown to form oligomers, bind membranes and induce membrane tubulation.
PSSM-Id: 153279
Aligned: 13 rows
Threshold Bit Score: 239.93
Threshold Setting Gi: 24648294
Created: 1-May-2009
Updated: 2-Oct-2020
Aligned Rows:
dimer interface
Feature 1:dimer interface [polypeptide binding site]

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                #  ##         # ##  ## ##                                ## ##  ## ##  #
Feature 1                             #  ##                                                      
XP_001640058  84 LGDMsllg--------mvlsQTGEAQLSIARSLCEFEMSVEKNVMIPMTTILe----nDIPNIYQAKKKLSKAALEMDTC 151 starlet sea ane...
XP_001898880  92 LENVyprsqps--vladtlkLYGDAMGVILEERVLTDQLIEKSVLDAFGKYMd-----DDKALSKAKEKLTRTVVDVEVS 164 agent of lympha...
XP_001649194 104 LPAGllrd---------vldRSARLEKTIASEIINNEMNIENSVSKNLNDIIe----rHLATIQKQKRTVSKCHQEYEAT 170 yellow fever mo...
Feature 1                                                                  #  ## #   #  ## ##  ##
XP_001640058 152 KSRYLAalktfqga--------skdpwgaqSKADALKEELENETAKFEACQDGFTTEALTFVAREaEFAEWMIKFIEAQQ 223 starlet sea ane...
XP_002205631 152 RSRYHSairssntg---------gnqaaamAKAESLKDEMDDAQSRMNLCRDALATDMYQFVSKEqEYAHNLISLVEAQI 222 Florida lancelet
XP_002120731 157 YQNWNKvhksqftp--------ganlqqitAKSEILKDEYDQAVIRMEQSKDQLVTDLFEFLAKEaGHGQRMSDFHAKQL 228 Ciona intestinalis
XP_969894    159 SNRYHA------------------------TKKEALRDDMEEADYKVEQSRDALAYEMFSLLAKEnDLAGYMLQILKCQR 214 red flour beetle
XP_001898880 165 RKRKQGnh--------------------deSKAQEIQDEYDALQLKLESYKDNIFTDIFILLSREaEIAGIYKELITAQM 224 agent of lympha...
XP_001649194 171 RQKYDSavrnsd-------------qlgnqAKLTQLKDDQEELHNKLEKERDLYESYMYELLAEEeNIANYVKDYVKHQE 237 yellow fever mo...
XP_002109180 149 KSRLNKekerss-------------gsvnmVKLKTLNDEYENNEKIFNQAQDGLAIEHLQFLSNEtMVASSVLNFVDHQM 215 Trichoplax adha...
XP_001746984 162 RRQNKEvn---------------------rPKVDALESDLHDAERALASQRAKYVEALVEVSAHErDFAIPLVNMILQQL 220 Monosiga brevic...
Feature 1          ## ##  ## ##                       
XP_001640058 224 EYHKSASMILQDVLPLLKTQVESSSLRSVFGCPLEEH 260 starlet sea anemone
XP_001898880 225 EYHRTALQKLENILPEIDRKIASYPNRPVFGCHLEDH 261 agent of lymphatic filariasis
XP_001649194 238 MYYTSALREIQGTIKNMDGLFRRNNKKIFNTPLQEHL 274 yellow fever mosquito

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap