Conserved Protein Domain Family
BAR_Endophilin_B

?
cd07594: BAR_Endophilin_B 
The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Endophilins play roles in synaptic vesicle formation, virus budding, mitochondrial morphology maintenance, receptor-mediated endocytosis inhibition, and endosomal sorting. Endophilins contain an N-terminal N-BAR domain (BAR domain with an additional N-terminal amphipathic helix), followed by a variable region containing proline clusters, and a C-terminal SH3 domain. They are classified into two types, A and B. Vertebrates contain two endophilin-B isoforms. Endophilin-B proteins are cytoplasmic proteins expressed mainly in the heart, placenta, and skeletal muscle.
Statistics
?
PSSM-Id: 153278
View PSSM: cd07594
Aligned: 11 rows
Threshold Bit Score: 315.1
Threshold Setting Gi: 76155451
Created: 1-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interfaceputative
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                #  ##   # ##  ## ##                            ## ##  ##
Q9Y371        24 QFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPNARIEEFvyekld--rkapsRINNPELLGQYM 101 human
Q8SYD9        26 QLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEKIVRDTESVLIPNPQNRVEDFifekie--kskpkRLSNLEHLALDM 103 fruit fly
Q20005        21 QLTEETFLKAERTELDSHFENLLQRADKTEDHTRRLLSAIEGYLQPNPTVRMEEVfyeklelkkdgaiRQNNLEQLSTAM 100 Caenorhabditis ...
XP_002109451  20 QYTEEKIGHSEKTQYDPQFENLQRRADRTKVWTEKLCKQMENVLQPNPTVRMEEFflekld--kkkrpRLTNHEVLGQLM 97  Trichoplax adha...
EEC02192      10 QYTEERLGTSDKTELDAHFETLAQRSDRTKFWTERLVGKTEAVLQPNPNVRVEDYlfekl---dkkrdRLNNTELLGQDM 86  black-legged tick
XP_002125621  29 QFTEEKLGNAEKTEYDANFENLQMRYDKTKHWTEKLKSQTEASLQPNPNTRMEDFvylkld--rkppdRVNNTEQLGLTM 106 Ciona intestinalis
XP_001630264  24 QYTEEQLGKAEATEFDARFESLLERADRTKQWTERLLKQTEALLQPNPGIRAEEYfysklg--ekkpeRLTHLETLGKIM 101 starlet sea ane...
XP_001191773  22 QYTEEKLGNAEKTELDARFENLLQRADRTRLWTEQILAKMGAVLEPNPNSRMEDFvntkld--rrardRESNSEQFGSAM 99  purple urchin
XP_001951018  22 QFTEEKLGKAEKTEQDPNFEQLVTFCDNTKQNTETILKNMECMRVENLFFLDKKKs------------GLSSSEYLGIAM 89  pea aphid
AAX26739      31 QTIEESINTAERTPYSSDLTSLIQESEKRRVWADSILAQLENVIQPNPALRVEDFilkgm---drkkvRLSANEQLGESM 107 Schistosoma jap...
Q8R3V5        21 QFTEEKFGQAEKTELDAHFENLLARADSTKNWTERILRQTEVLLQPNPSARVEEFlyekld--rkvpsRVTNGELLAQYM 98  house mouse
Feature 1         ##  #             #  ##                                                        
Q9Y371       102 IDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKK 181 human
Q8SYD9       104 IEAGGDFGQDLPYGQALIKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNRVKK 183 fruit fly
Q20005       101 TEAGEQFGETTPYGSALLKVAQTENRLGQAERELCGQAATNTLLPIRRFLEGDMKTIQKERKVLNSKRLDLDACKSRLKK 180 Caenorhabditis ...
XP_002109451  98 TSAGNDYGPNTALGGALIKVGNVQAKIGLSEREFVETSARKFIKPCKTYIENDCKSISKERKLLAVKRLDLDACKSKLKK 177 Trichoplax adha...
EEC02192      87 IDAGTDFGPGTSYGTALIKVGQAQHKLGHAEREFGRLVHTNYVQPLRRFLEGDMKTILKERRLLEHKRLDLDAAKNRLRK 166 black-legged tick
XP_002125621 107 IEAGNDFGPGTAYGGALVKCGEAQMKLGQAQQTFIQTTLQNFLQPLSNFLEGDCKTIQKERKTLEKKRLDLDASKAKVRR 186 Ciona intestinalis
XP_001630264 102 EDAGNELGPGTSYGSTLVKCGATEKKLASAERDFMTKSVSHYLHPLKSFLEGDMKTISTERRTLLAKRLDLDSCKAKVRK 181 starlet sea ane...
XP_001191773 100 IDGGNELGPGTQYGATLIQVGQSQRKIGQIQREYVQSSLTNYIVPLRTFLEGDMKTITKERKILENVRLDLDAAKGKVRK 179 purple urchin
XP_001951018  90 TEAGNDFGPDTAYGSALIKVGNIQQTLGLNQREFIKSANDCFVNPMNKYLETDMKTVVKERSLLEKRRLDLDACKTRVRK 169 pea aphid
AAX26739     108 DHIGCLINETSRGGEALRKCAAAQKKIGESERRLQDTVSSEYISWLRLFTTNEVKVAKQEREKLENARLDLDRLKTMQKR 187 Schistosoma jap...
Q8R3V5        99 AEAASELGPSTPYGKTLIKVSEAEKRLGAAERDFIHTASLSFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKK 178 house mouse
Feature 1                                                                     #  ## #   #  ## ## 
Q9Y371       182 Akaaet-----------------------------rnssEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVE 232 human
Q8SYD9       184 Arsmlgqqskdg-----------------ispeavleqaERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQ 246 fruit fly
Q20005       181 Aktvdlqtvtns----------------ktsggftieqaEADVRVAQAEFDKQSEITKLLLEGIQTAHNNQLKCLRDFVE 244 Caenorhabditis ...
XP_002109451 178 Avstekaqa----------------------vifvilqaDNDLRAAQSEFDRQHEITKLMLDGVGSTHTNQLRSLGEFVE 235 Trichoplax adha...
EEC02192     167 Aksvd-------------------------------pqaEKDMRTSQSDFDRQAEITRLLLEGISSTHVNHLRCLSDFVE 215 black-legged tick
XP_002125621 187 Aktlea-----------------------------rqvsESELRITQTDFDRQQEITRLLLEGVSSTQAHHSRSLNEFVD 237 Ciona intestinalis
XP_001630264 182 Aqtper-----------------------------iqqaESELRVAQAEFDRQYEVTKLLLDGIATSHANHHRALQSFIE 232 starlet sea ane...
XP_001191773 180 Arsaea-----------------------------skaaEAELRKAQADFDRQYEITTLLLEGITSAHSTHLERLKDFVE 230 purple urchin
XP_001951018 170 Trmlat----------------------------tkvkaEHDLKVAQEEYNRQAEITKLLMEGVPSAHPQHLQHLLDFVD 221 pea aphid
AAX26739     188 Akndk------------------------------qhehDQLVKEAQSKFASQCAITKQVLQESIDKFDSQKDELRKLLT 237 Schistosoma jap...
Q8R3V5       179 AkaaeakattvpdfqetrprnyilsasasalwndevdkaEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVK 258 house mouse
Feature 1         ##  ## ##  ## ##   
Q9Y371       233 AQMTYYAQCYQYMLDLQKQL 252 human
Q8SYD9       247 TQVRYYKQCGDVMEQLQREL 266 fruit fly
Q20005       245 AQMSFYAQSHQLMADLQREL 264 Caenorhabditis elegans
XP_002109451 236 AQLKYYLTSYRELIELQKQL 255 Trichoplax adhaerens
EEC02192     216 AQMSYYAQCQQYMADLQKEL 235 black-legged tick
XP_002125621 238 AQTEYYAKCYQCMKDLQAQL 257 Ciona intestinalis
XP_001630264 233 AQAQYYAQCFQYMQDLQRQL 252 starlet sea anemone
XP_001191773 231 AEQTYYAQCSQTMTELQQQL 250 purple urchin
XP_001951018 222 TQAAFYLKCHESLMSLQSDL 241 pea aphid
AAX26739     238 AQSDYFRACSEAVDSALRAI 257 Schistosoma japonicum
Q8R3V5       259 SQTTYYAQCYRHMLDLQKQL 278 house mouse

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap