1ZWW,2Z0V


Conserved Protein Domain Family
BAR_Endophilin_A

?
cd07592: BAR_Endophilin_A 
Click on image for an interactive view with Cn3D
The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Endophilins are accessory proteins, localized at synapses, which interact with the endocytic proteins, dynamin and synaptojanin. They are essential for synaptic vesicle formation from the plasma membrane. They interact with voltage-gated calcium channels, thus linking vesicle endocytosis to calcium regulation. They also play roles in virus budding, mitochondrial morphology maintenance, receptor-mediated endocytosis inhibition, and endosomal sorting. Endophilins contain an N-terminal N-BAR domain (BAR domain with an additional N-terminal amphipathic helix), followed by a variable region containing proline clusters, and a C-terminal SH3 domain. They are classified into two types, A and B. Vertebrates contain three endophilin-A isoforms. Endophilin-A proteins are enriched in the brain and play multiple roles in receptor-mediated endocytosis. They tubulate membranes and regulate calcium influx into neurons to trigger the activation of the endocytic machinery. They are also involved in the sorting of plasma membrane proteins, actin filament assembly, and the uncoating of clathrin-coated vesicles for fusion with endosomes. The BAR domains of endophilin-A1 and A3 form crescent-shaped dimers that can detect membrane curvature and drive membrane bending.
Statistics
?
PSSM-Id: 153276
View PSSM: cd07592
Aligned: 16 rows
Threshold Bit Score: 316.558
Threshold Setting Gi: 156401392
Created: 1-May-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interfaceputative
Conserved site includes 47 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Structure:2Z0V; interface between monomers of human Endophilin-A3 BAR domain dimer; defined at 4A contacts.
    View structure with Cn3D
  • Structure:1ZWW; interface between monomers of Mus musculus Endophilin-A1 BAR domain dimer; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                     ##  ## ##  ##  #   #  ##                           ## ##  ##  #  ##
1ZWW_A        25 EGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRaklsmintmskirgqekgpgYPQAEALLAEAMLKFGREL 104 house mouse
2Z0V_A         9 EGTKLDDEFLDXERKIDVTNKVVAEILSKTTEYLQPNPAYRaklgxlntvskirgqvkttgYPQTEGLLGDCXLKYGKEL 88  human
O61843        25 EPTKLDDVFNEMEKNVDTTYNLITDLVAGTNEYLQPNPATRakmatqvalskvrgttktspYPQTEGMLADVMQKYGQQL 104 Caenorhabditis ...
Q8T390        25 EGTKLDMDFMEMERKTDVTVELVEELQLKTKEFLQPNPTARakmaavkgisklsgqaksntYPQPEGLLAECMLTYGKKL 104 fruit fly
XP_002231833  32 EATKLDDDFLEMEKKIDTMDELSIELITKTKEYLQPNPASRarlaaqnqfskirgqarttqYPQPEGTLGDCMMKYGREL 111 Florida lancelet
EEC12226      25 EGTKFTEEYMEMERKIDLTNELVEELIVKTKEYLQPNPASRaklmvstkl---rgtgkthaYPQPEGVLGETMVKYGGDL 101 black-legged tick
AAW25789      25 EGTKLDDEYVEIEKKVDTISKLFEDVIAQTHEFLQPNPAYRaklmtmntlnklqgksknasYPQPENQLGECMIKYGRDL 104 Schistosoma jap...
XP_001623261  25 KGSQLEEEFVELERKTDSTAKLIEDVLHKTKEYLQPNPAARaklsmqgavhkvrgearstrYPQPEGNLGETMVKGGQDL 104 starlet sea ane...
XP_002164519  25 KGSQLEEEFKELERKIDIVTKAVDDLHNKSREYLQPNPSARtklavqasyqkargqtksakYPQVEQNLADVFLKAGADL 104 green hydra
XP_002110909  25 QGTKLDDQFLELEKQTDALAASVENIKSRTIEVLQPNPAARfklhtqgayqkitgsaknvkYPQPEFVLGEVMIKSSTEL 104 Trichoplax adha...
Feature 1           #   ##  ##                                                                   
1ZWW_A       105 GDDC---NFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFGYKKKRQGKi--- 178 house mouse
2Z0V_A        89 GEDS---TFGNALIEVGESXKLXAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKi--- 162 human
O61843       105 GDNS---DLGKSLNDAAETYRQMADIKYQMEDNVKQNFLDPLTHLQNNELKDVNHHRTKLKGRRLDYDCKKRQQRR---- 177 Caenorhabditis ...
Q8T390       105 GEDNs--VFAQALVEFGEALKQMADVKYSLDDNIKQNFLEPLHHMQTKDLKEVMHHRKKLQGRRLDFDCKRRRQAK---- 178 fruit fly
XP_002231833 112 SEGSvssEYGEALSEMGETLKQMAEVKYNLDATVKQNYLDPLQQLHEKDIKEVLHHRKKLQGRRLDYDCKKRQKEKgsk- 190 Florida lancelet
EEC12226     102 GEES---PFGQSLIEAGESLKQLADIKYALEDNVKQNFLEPLTQLQTKDLKDVLHHRKKLQGRRLDYDCKKRTQIRgah- 177 black-legged tick
AAW25789     105 GPES---CYGQCLVQAGESFKYLADIKYTMEEHVKENFLDPLHSVQTHELKEINHHRKKLEGRRLDFDCKKRKQDRsasn 181 Schistosoma jap...
XP_001623261 105 GDTS---LFGQAMVEAGETFLQLAEVKDALDANVKQNFLDPLTQLENRDIKEIMQHRKKMQGRRLDYDCKKRKSNKl--- 178 starlet sea ane...
XP_002164519 105 NDEL---PYSQSLMACGNTFTQIAEIKDSLEFSVKQNFLDPLYQLQQKDLKEINHHRKKLESRRLDFDYKKSKGAKgv-- 179 green hydra
XP_002110909 105 GEDL---ILSQTLVDVGECMKQIADAKDALDANIKQNFLEPLTLLQTKDLKEVMHHRKKLSGRRLDYDCKRRKKDRgsn- 180 Trichoplax adha...
Feature 1                                        ## ### ##  #  ## ### ##  ## ##  #   #   
1ZWW_A       179 ---pDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA 247 house mouse
2Z0V_A       163 ---pDEEVRQAVEKFEESKELAERSXFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQXRISAA 231 human
O61843       178 ----DDEMIQAEEKLEESKRLAEMSMFNVLSNDVEQISQLRALIEAQLDFHRQTAQCLENLQQQLGHRIKDA 245 Caenorhabditis elegans
Q8T390       179 ----DDEIRGAEDKFGESLQLAQVGMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQEKRSEA 246 fruit fly
XP_002231833 191 --vsDDDLRSAMEKFEESKELAENGMYNLLESDVEQISQLQTLANSMLEYHQQSTELMEQLCSKLQSRVDDA 260 Florida lancelet
EEC12226     178 --atEDDIKLAEDKFEESFNLASMGMFNLLENDVEQISQLAALAEAFCEYHQQCAEVLQSLTERLLEQLTEA 247 black-legged tick
AAW25789     182 srlpEDELKIAEEKFQESKLLAEPAMINFLNSETDQVQSLTEFITAQADYHRQATDIMEQLRKFLIDKKDET 253 Schistosoma japonicum
XP_001623261 179 ---pLEDIRIAEEKFEESKELCYNSMMNLLDGEAEQISQLSALSEAILDYHKHAAEVMQSLVSTLNDRVTEA 247 starlet sea anemone
XP_002164519 180 ---pEEELNIAEEKFTESKELCYNSMMNFIDSDVEHIGQIHAFAEAVRDYHHQCADLMDALVKKLAENLSEA 248 green hydra
XP_002110909 181 --vsDDDLKIAEEKFLESKELAESGMINLFDNESDQIGQLLELIKGLMQYYAQGAELLGNLTHVVQQKMDEA 250 Trichoplax adhaerens

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap