Conserved Protein Domain Family
BAR_Rvs161p

?
cd07591: BAR_Rvs161p 
The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 161 and similar proteins
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. This subfamily is composed of fungal proteins with similarity to Saccharomyces cerevisiae Reduced viability upon starvation protein 161 (Rvs161p) and Schizosaccharomyces pombe Hob3 (homolog of Bin3). S. cerevisiae Rvs161p plays a role in regulating cell polarity, actin cytoskeleton polarization, vesicle trafficking, endocytosis, bud formation, and the mating response. It forms a heterodimer with another BAR domain protein Rvs167p. Rvs161p and Rvs167p share common functions but are not interchangeable. Their BAR domains cannot be replaced with each other and the overexpression of one cannot suppress the mutant phenotypes of the other. S. pombe Hob3 is important in regulating filamentous actin localization and may be required in activating Cdc42 and recruiting it to cell division sites. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153275
View PSSM: cd07591
Aligned: 12 rows
Threshold Bit Score: 348.948
Threshold Setting Gi: 223641169
Created: 12-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                          #  ##   # ##  ## ##         ## ##  ## ##  #                   
P25343        18 IIKNVDKTIDKEYDMEERRYKVLQRAGEALQKEAKGFLDSLRAVTASQTTIAEVISNLYDDskyvagg------------ 85  baker's yeast
EDK38676      20 KAGQVDVTVDTEFEFEEKRYRTMQSHSRKLHSELKYYLDTLRRLESAQLSVAKALSSFYGQqqgekp------------- 86  Pichia guillier...
XP_761430     20 KTGQVERTVDAEFNSTEEQYRTLEREVMSLQKEAKAYLDAMRSLASSQARIAEAIDGFYTDssdaa-------------- 85  Ustilago maydis...
CAR65940      20 KTGHIEETVDKDYEFEEKRFKYMESTSTKLQKELKHYLDSLRILTNAQVNVSEVLSEFYGSnknedke------------ 87  Debaryomyces ha...
XP_001830068  38 KTGQIERTIDREFTEEEEKYRVFEKECQALQKDSKGYWDAMKAMTSAQARIADTIEIFYGAadrgseg------------ 105 Coprinopsis cin...
Q8X0D7        32 KTGHVEKTNDRDYEVEERRFKTMEAASLRLQKEAKGYLDSLRAMTASQMRIAETIDAFYGEagakd-------------- 97  Neurospora crassa
XP_777514     20 KTGQVERTIDREFAEEEGRYKTMEKETLNLQKEAKTYLDSMRSMASSQSRIAETVALFYSAdrtsdg------------- 86  Cryptococcus ne...
XP_001729876  20 KTGQLERSDDSRFKEEEHKYRELEKHASALLKCSRDYLDSIRLLSASEARIGDTIEGFYHDnsepa-------------- 85  Malassezia glob...
XP_501584     20 KTGHVEKTVDREFETEERRYRTMETASTKLNKEAKGFLDSLRAMTSSQTRIAETIDAFYGDagtrd-------------- 85  Yarrowia lipoly...
EAZ63153      20 KTGQIESSTDKEFEFEEHRYRAMETTSTKLQRELKHYMESLRLLSNAQINVGESLSSFYGAspsselgadks-------- 91  Pichia stipitis...
CAX45546      20 KTGHIEQTVDKEYDFQEKRYRTMEENSIKLQKNLRLYLDSLRLLTNSQINIAESLNSFYGTnndksnvsrtgsvstrnki 99  Candida dublini...
NP_595489     20 KTGHVERTVDREFETEERRYRTMESAAKKLQKEAKGYLDALRAMTASQTRIANTIDAFYGDagskd-------------- 85  fission yeast
Feature 1                                                  #  ##                                 
P25343        86 ----------------------------------gynvgnyYLQCVQDFDSETVKQLDGPLRETVLDPITKFSTYFKEIE 131 baker's yeast
EDK38676      87 -----------------------------------tslaqeYYTALEKTHDEVAKALETPYHQTVLNPVARFNSYYIEID 131 Pichia guillier...
XP_761430     86 ------------------------------------msanaYRRAVDELDTKTAKEIDAPYRATVLEPIGKLASYFPEIN 129 Ustilago maydis...
CAR65940      88 ----------------------------------yksisqeYHGVMKLLNDQAVGELEQPFNQTVLNPIARFNSYYIEIN 133 Debaryomyces ha...
XP_001830068 106 -----------------------------------amaghaYKRSVDELDSGFTRELDVPYRTAILEPLGKMCSYFPVIN 150 Coprinopsis cin...
Q8X0D7        98 ------------------------------------gvsksYKQAVEDLDAETIKALDGPYRTTVLDPITRFCAYFPDVN 141 Neurospora crassa
XP_777514     87 -----------------------------------amaghaYKSAVDELDAGVGRELDAPFRATVLDPIGKLNSYYTNID 131 Cryptococcus ne...
XP_001729876  86 ------------------------------------iiatsYKRALEELDARTAKELDAPYRATVLDPIGKLCSYFPEVN 129 Malassezia glob...
XP_501584     86 ------------------------------------giskyYLQAVQELDAETVKALDGPYRETVLDPITRFCAYFTDIN 129 Yarrowia lipoly...
EAZ63153      92 -------------------------------tvkhselsqlYYDVVKDLSEKCFTDVETPYNQTVLNPVSRFNSYYVEVN 140 Pichia stipitis...
CAX45546     100 psiheeeekeeeeeeeeekegdnntitnktitssynnliqeYYATIKQLNDSCITNLENPYNQTVLNPIARFNSYYIEIN 179 Candida dublini...
NP_595489     86 ------------------------------------gvsayYRQVVEDLDADTVKELDGPFRTTVLDPISRFCSYFPDIN 129 fission yeast
Feature 1                                                                                    #  #
P25343       132 EAIKKRDHKKQDFDAAKAKVRRLVDKPAKDa-----------------SKLPRAEKELSLAKDIFENLNNQLKTELPQLV 194 baker's yeast
EDK38676     132 EAIKKREHKRLDYDALRAKVQKLIDRPDEE------------------EKLKDTEQQLDGSREVYEKLNEELKHELPRFT 193 Pichia guillier...
XP_761430    130 KIIEKRNKKLLDYDAARSKHRKLVDKPSDDp-----------------TKLPKAEKELEDARLIFETLDDQIKSELPQLV 192 Ustilago maydis...
CAR65940     134 EAIKKRNHKKLDYDAMKNKVRKLIEKPGEDps--------------yeSKLSQNQSQLTQLETTYETINDQLKDELPKLI 199 Debaryomyces ha...
XP_001830068 151 EHISKRNKKLLDYDSARSKLKKLIDKPSEDp-----------------TKLPRAQQENDEAKEVFDMLNDQLIAELPQLL 213 Coprinopsis cin...
Q8X0D7       142 ECIKKRGHKLLDYDALRAKVKKLVEKPDKDv-----------------TKLPRAEKEMEMAKAAYEQLNEQLCTELPQLI 204 Neurospora crassa
XP_777514    132 AAITKRSHKMSDYDAARAKVRKLVEKPSDDs-----------------TKLPRAQSEHDEARDIFNILNDQLITELPILV 194 Cryptococcus ne...
XP_001729876 130 KLIDKRGRKLLDYDATRSRYKKQSDRPSDDp-----------------SKLPRMESEHNEAKLVFDALNEQLMTELPQLV 192 Malassezia glob...
XP_501584    130 EAIKKRNHKLMDYDALRHKTKKLIEKPSNDa-----------------ARLPQAEKEEQMAKEMYSQINNQLIEELPQLI 192 Yarrowia lipoly...
EAZ63153     141 EAIKKRARKQIDYDALKSKVKKLIEKPNSSdae-------------yeTKLASAQSDLQESEKTYLALNDQLKDELPKLV 207 Pichia stipitis...
CAX45546     180 EIIKKRHNKLLDYDAMKNKLRKLIDNPTTNispsmktnvvesnhnqyeEKLKSYNQELTEVESKYVEINNQLLTELPKLI 259 Candida dublini...
NP_595489    130 AAITKRNHKLLDHDAMRAKVQKLVDKPSNDt-----------------TKLPRTEKEAAMAKEVYETLNNQLVSELPQLI 192 fission yeast
Feature 1        # #    #  ## ##  ##  ## ##  ## ##                
P25343       195 SLRVPYFDPSFEALIKIQLRFCTDGYTRLAQIQQYLDQQSRDDYANGLL 243 baker's yeast
EDK38676     194 NLRIPFFDPSFEAFARLQMRYFRENYESLAQLETKLDAQTRKDYMDGTL 242 Pichia guilliermondii ATCC 6260
XP_761430    193 DLRIPYLDPSFEAMVRIQAKFSEDGYEKLGGVQRFFADGVREQYADGQL 241 Ustilago maydis 521
CAR65940     200 DLRIPFLDPSFESFVKLQLRFFNENYNHLNNLQVKLDAQTRQDYISGAL 248 Debaryomyces hansenii
XP_001830068 214 DLRVPYFDPSFEAMIRMQSKFAEEGYEKLSGVQRYFADNVRDDYAAGQL 262 Coprinopsis cinerea okayama7#130
Q8X0D7       205 DLRVPYLDPSFEALVKIQLRFCAEAYSRMAQVQQYLDPDTREQYAQGQL 253 Neurospora crassa
XP_777514    195 DLRIPYLDPSFEAMIRCQLNFAQEGYERLAGVQRYFADSIRDDYANGAL 243 Cryptococcus neoformans var. neoformans B-3501A
XP_001729876 193 DMRIPYLDPSLEMMIRVQIKFAQEGYEQLGGVQRYFPEQVRTDYAEGQL 241 Malassezia globosa CBS 7966
XP_501584    193 DLRVPYLDPSFEALVKIQLRFCTESYTRLAQVQQYLDASSREEYANGQL 241 Yarrowia lipolytica CLIB122
EAZ63153     208 NLRIPFLDPSFEAFVKIQLRFFTESYEELNNLQMKLDAKTREDYINGKL 256 Pichia stipitis CBS 6054
CAX45546     260 NHRISYFDPSFESFVKIQLRFFNENYHVLNQLQLKLDARTRQDYIEGKL 308 Candida dubliniensis CD36
NP_595489    193 ALRVPYLDPSFEALVKIQLRFCREGYEKMAQVQQYFDNSVREDYSNGLL 241 fission yeast

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap