Conserved Protein Domain Family
BAR_Bin3

?
cd07590: BAR_Bin3 
The Bin/Amphiphysin/Rvs (BAR) domain of Bridging integrator 3
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Bridging integrator 3 (Bin3) is widely expressed in many tissues except in the brain. It plays roles in regulating filamentous actin localization and in cell division. In humans, the Bin3 gene is located in chromosome 8p21.3, a region that is implicated in cancer suppression. Homozygous inactivation of the Bin3 gene in mice led to the development of cataracts and an increased likelihood of lymphomas during aging, suggesting a role for Bin3 in lens development and cancer suppression. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153274
View PSSM: cd07590
Aligned: 10 rows
Threshold Bit Score: 268.082
Threshold Setting Gi: 110762717
Created: 1-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                          #  ##   # ##  ## ##  ## ##  ## ##  #                    #  ## 
EAW63655     119 KKQIVPKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSKSAVKISLDLlsnplceqd-qdllnmvtALDTAMK 197 human
NP_001088770  11 KKQIVPKTVERDFEREYGKLQQLEDQIKKLQKDMKKSIEADLAMSKSAVRISSDLlgnplcepd-vdflqmvtALDTAMK 89  African clawed ...
NP_001116516  12 RKQIVSKTVERDFEREYEKLQKLEEQTKKLHKDMKKSTEADLAMSKAAVKISGDLlsnplceqd-qhfldsmnALDTAMK 90  zebrafish
XP_002238924  14 KRTVISKTVEKDFERECTKLAQLDESTKKLYKDMRKCTEAVTALSKCEVKLGQDLvstcqged---mlrneaeAVGATTA 90  Florida lancelet
XP_001634782  15 KARQTGKQADNDFEKECARFYQFESATKKVYKGMKRYGEAMLALNKAEQRIFQDLasgplaqt--dllqepvdEFSKVTA 92  starlet sea ane...
XP_002163368  11 KKTILDKKTCFEYESNIERLNKVEASTRKVYKEGKKHLESNAALSKMQQRFAQELnvgtsiketderlfnitqSLQQTLV 90  green hydra
EEC10165      14 RTSPGGELDEKTVEEYVSKFVRLETDTKKLHKDAKKYEDAMLALYHCEKKMSSDLangelcndn-pelrrlveEWLSFAS 92  black-legged tick
XP_002114540   8 VLNKRYIGGDRRLDEYCNELQHVESCAKKLLKDGKKCIDVGKATMKIEEQVFDCLcdvhscvg--ksndrlanDVDILKE 85  Trichoplax adha...
XP_001604984  18 AQPCLTVAEDRELDITVQRIIHVENTVRRMIKEMKKYLTTIEHLDSVDQRLTTNLsscslvhin-defrkiveDYHSVTT 96  jewel wasp
XP_001121406  18 APPLFSHSEDRELDIAVQKLICIEDTIRKLTKEMKKYIEAVINLDRADQRLTLNLttcglahln-defrkvveNYHSVTT 96  honey bee
Feature 1                                                                                        
EAW63655     198 RMDAFNQEKVNQIQKTVIEPLKKFGSVFPSLNMAVKRREQALQDYRRLQAKVEKYEEKEKTGpv-lAKLHQAREELRPVR 276 human
NP_001088770  90 RMDAFNQEKVNQIQKTVMDPLKRYSSVFPSLNMAVKRREQALQDYKRLQTKVEKYEEKDKTGam-iAKLHQAREELRPVR 168 African clawed ...
NP_001116516  91 RMDAFNQEKVNQIQKTVIDPLKKYGSVFPSLNMAVKRREQALQDYKRLQSKVEKYEEKEKTGpi-mVKLHQAREELKPVR 169 zebrafish
XP_002238924  91 KLEGFSQELNTSSQKAVIEPMKRFTNIFPQANSAIRKREQSLQEYSRQQLKVEKLQEKERTGpn-iVKLEQGKKALSAAK 169 Florida lancelet
XP_001634782  93 KLDELRQELVSRNQKTFLDPMKRLRSVFPSVNDAIRAREQSFMEYAKHQAKVEKLAEKERTPqn-lAKLEQAEKDLAKAK 171 starlet sea ane...
XP_002163368  91 HQSELLRELNNNIQKSFVDPMKKFTSNFALVNNAIKRRDQSLSEYTKYNNRREKFLEKESQS----GKFDANERYLALAK 166 green hydra
EEC10165      93 SMDSAVDDHLVAIRRCLVDPLKRYQTVFTEVQAALKRRNQVAQECVRLEQRAERLAGRETTGpn-lAKLSECKQALEAAR 171 black-legged tick
XP_002114540  86 SLHHTAEGLIYNFRKTIAEPLHRLNSIFPHANAAIAKFDGTFKECEKLQAKVDKLIDKARSPqq-dVKLEQNEKALARVK 164 Trichoplax adha...
XP_001604984  97 QIEKTAQDTVALCNKTFIEPLKKLKEEFAYIRDALAKREELVNNWKISYGILKKYQEKRDKTashhVKLERERRAEEIAS 176 jewel wasp
XP_001121406  97 QIGKTVQEMAILCQKTFIEPLKKLRDEFILIAAKKDRTANHIAKLERERRAEETAAKELKAVh---AQLLVELPMFLDKR 173 honey bee
Feature 1                      #  ## #    #  ## ##   ##  ## ##   ## ##                
EAW63655     277 EDFEAKNRQLLEEMPRFYGSRLDYFQPSFESLIRA-QVVYYSEMHKI-FGDLSHQLDQPGHSDEQRERE 343 human
NP_001088770 169 DDFEAKNHQLLDEMPKFYNSRTDFFKPSFQSLIRA-QVVYYTEMSRV-FGDLAQQVDEVQLSDAEREQE 235 African clawed frog
NP_001116516 170 EDFEAKNKQLLDEMPKFYNSRIDYFQPSFEALIRA-QVVYFTEMHKI-FTELNDQIDQSALTDEQRKQE 236 zebrafish
XP_002238924 170 EDFEVQNSSLMEEMPQFYDGRIDYFQPCFEALLKS-QVAYHSNVYKV-LCELASDLGADTDPPPDHQYN 236 Florida lancelet
XP_001634782 172 ADYERQNAVMLEDLPMLTNGRVDYFEPCFEALILS-EASYYSQSAQA-LTNLTNLLSRSSEQLKIEEQQ 238 starlet sea anemone
XP_002163368 167 ADFERRNIKLMEELPKFFDCRSTYFMLCFKGLVKS-EHDYFSKSREI-FEQLAEKVDCPIEQLTEEEYR 233 green hydra
EEC10165     172 GDLRTQGALLAQDLPRWYQASNLYLQPCLEALMHS-QTLHWGQATTCaHNLLAPGAKVPVEQRLAAVRA 239 black-legged tick
XP_002114540 165 AEYEKSHEALLEDVESFCRNYREYFNASIEAYFKM-QALFYDDYDRT-LDSISNNFDLTAAELDDSAFD 231 Trichoplax adhaerens
XP_001604984 177 KELKIYHGKLLAELPMFLEKRLEYLNPTVQALIAI-QLDYYGNSTKM-FTQLMPFRRSSSQSAERSGSF 243 jewel wasp
XP_001121406 174 LEYIKPSIHALIMIQLDYYGSTTHLFTHLMPIPNAsESPSSAMIPENeYQQAMANQINRIRGLTIVKDH 242 honey bee

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap