2FIC,1URU


Conserved Protein Domain Family
BAR_Amphiphysin

?
cd07588: BAR_Amphiphysin 
Click on image for an interactive view with Cn3D
The Bin/Amphiphysin/Rvs (BAR) domain of Amphiphysins
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Amphiphysins function primarily in endocytosis and other membrane remodeling events. They contain an N-terminal BAR domain with an additional N-terminal amphipathic helix (an N-BAR), a variable central domain, and a C-terminal SH3 domain. This subfamily is composed of different isoforms of amphiphysin and Bridging integrator 2 (Bin2). Amphiphysin I proteins, enriched in the brain and nervous system, contain domains that bind clathrin, Adaptor Protein complex 2 (AP2), dynamin and synaptojanin. They function in synaptic vesicle endocytosis. Some amphiphysin II isoforms, also called Bridging integrator 1 (Bin1), are localized in many different tissues and may function in intracellular vesicle trafficking. In skeletal muscle, Bin1 plays a role in the organization and maintenance of the T-tubule network. Bin2 is mainly expressed in hematopoietic cells and is upregulated during granulocyte differentiation. The N-BAR domains of amphiphysins form a curved dimer with a positively-charged concave face that can drive membrane bending and curvature.
Statistics
?
PSSM-Id: 153272
View PSSM: cd07588
Aligned: 10 rows
Threshold Bit Score: 308.513
Threshold Setting Gi: 74965022
Created: 1-May-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interfaceputative
Conserved site includes 36 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                           #  ##   #  #  ##  #         ## ##  ## ##  #       #          
2FIC_A        41 QKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWpGRDEANKIAENNDLL 120 human
1URU_A        26 QNLGKVDRTADEIFDDHLNNFNRQQASANRLQKEFNNYIRCVRAAQAASKTLXDSVCEIYEPQWsGYDALQAQTGASESL 105 fruit fly
Q21004        22 EGIGKAKATQDEVFDQHAANLNKQSKSCEKLHKDVKNYSSALRTLLSAEKQLRDTIRDAYEPEWpDREHLTAIFDNLDIQ 101 Caenorhabditis ...
Q803I3        38 QKLGKTMETKDEQFEECSANLNKQQTDGIRLYKDVKAYYNAVKVMHESSKRLSQTLKDIYEPDWhGVEDLTVIMESEDLL 117 zebrafish
Q8WQ54        37 QKLGKSDQTRDEVFEEFVNNFHKQNASAIKLQKELMKYMNSIRVLYQNTKSMSDTLKELYEEDWdGCEKQRELMEQRILL 116 Geodia cydonium
XP_782507     26 QKLGKADETRDELFEHYVQNFTSQQAAANRLFKELKNYVTCVKAMSQASKCLFEAMESTYESEWqGQEQLASVRETLDLL 105 purple urchin
XP_001891683  22 EGLGKAKATQDDVFDQHAANLVKQSKACERLYRDLKAYSAALRTMVQAQKTFRETIRELYETDWpDREHLCAITQSMDLQ 101 agent of lympha...
XP_002116550   3 QKLGKADETRDESFDEHVNNFNKQQAEVHKLHKEFKQYLSCLKDMKTAASNLNEAISEVYDGEWgGYSELVSVFEDSKTL 82  Trichoplax adha...
XP_002124813  30 RTFGVGEETKDEIIDNYVHLVNKQQNQVNKFQRDIKTYLNSITAMKTAAKMFYDSLGDLYEDEWmGKDMLASLAKTTDLL 109 Ciona intestinalis
XP_001626424 247 KTSGRQPSPRSFHSCAAVGNRMVVFGGRGLANQHFNDLHIFDVAMLSASADFSEAMKDVYEPDWsGRDVVFKLLDQLHVY 326 starlet sea ane...
Feature 1                                                                                        
2FIC_A       121 WMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAkk--kDEAKIAKAEEELIKAQKVFEEM 198 human
1URU_A       106 WADFAHKLGDQVLIPLNTYTGQFPEXKKKVEKRNRKLIDYDGQRHSFQNLQANankrkDDVKLTKGREQLEEARRTYEIL 185 fruit fly
Q21004       102 TNELEKTVCDDLPQTVTQYVNQFPDLKKKIEKRGRKLVDYDSAKNSFNSVKASsk-kdNDPKLAKATMELQAAEQMYTEM 180 Caenorhabditis ...
Q803I3       118 WNDYEEKLNDQVVRTMENYTAQFQDVKERVAKRGRKLVDYDSTRHHLEALQSAkk--rDDAKVNKAEEEFNKAQEVFEDI 195 zebrafish
Q8WQ54       117 WEDLLTSLTSRTVEPMTNYISRFSDVKTRIQKRERKMVDYDLRRRELEHAKSKak--vNDQKVQQAEDTHTQAKQLYDEI 194 Geodia cydonium
XP_782507    106 WDDYQRKLIDQIMNPLVSYQAKFPEVKKRMEKRGRKLIDYDSARHNLEASKKK-----DDQKYIKTQEAYNEARKLYEEL 180 purple urchin
XP_001891683 102 WDEFEKIISDRVMGSVNAYMAQFSELKAKVAKRGRKLVDFDGARNNYATVKASskkgdDDPKVVKALADLQQAETLYREL 181 agent of lympha...
XP_002116550  83 WNNLALRLSEEVVSPFAIYQSQFPEFKSRIAKRGRKLIDYDACRHNLDVSTKRk---aDDRKISQLEEEEMVSKKIYDEL 159 Trichoplax adha...
XP_002124813 110 YNDLHARLSSEVITALHDHLNQCNEMKIKVGKRGRKLVDYDASRRNLHTMQNSkk--lEESKITKAREHVLQTQSTYDTF 187 Ciona intestinalis
XP_001626424 327 YADLQEKLQDEVLGPLTAYQSQFPDIKARINKHGRKLVDYDRYRHNYEAMRAKgk-gvDQKKLNQCQEEFSEAKSVYTKL 405 starlet sea ane...
Feature 1                #  ## #    ## ##  ##        ##  ## ##   #  #        
2FIC_A       199 NVDLQEELPSLWNSRVGFYVNTFQSIAGL-------EENFHKEMSKLNQNLNDVLVGLEK 251 human
1URU_A       186 NTELHDELPALYDSRILFLVTNLQTLFAT-------EQVFHNETAKIYSELEAIVDKLAT 238 fruit fly
Q21004       181 NNELLEILPAVFDSRITFFVDTLQTLFNAnsvyqtdASKFHKQIVMQLDKLGESMDYLRV 240 Caenorhabditis elegans
Q803I3       196 NKELREELPVLYQSRISCYVTMFQNISNL-------RDVFYKEMSMLNHNIYNMMKKLED 248 zebrafish
Q8WQ54       195 TDELYEELPTLYDSRIQFYGQIFQSIAAA-------ETRFHAEISKVDEDLARVMDGLAS 247 Geodia cydonium
XP_782507    181 NSDLHEELPSLFDSRIPFYANTFQLLSAA-------ESTFYEEVGKAKGSVSTIMGDLYQ 233 purple urchin
XP_001891683 182 NKELVDTLPATYDSRITFFVDTLQTIFNA-------ESTNHAECGKNNKTLVTLLDNLGN 234 agent of lymphatic filariasis
XP_002116550 160 NTQLSNELPAIYDSRVAFYVSTLQSYFAT-------QIEFNKNITKVRCSVEIKCNQNGT 212 Trichoplax adhaerens
XP_002124813 188 NTQLHDELPNLYDSRVLLCTDTLINIATA-------EKSFYLELAEVRTKLMHVLVNLKD 240 Ciona intestinalis
XP_001626424 406 HAELYEELPALYDSRIAFYVSSFQSIFTA-------EAIFHREAGKIKTQMNDLMDGLVD 458 starlet sea anemone

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap