1UF8,1FO6,1FO6


Conserved Protein Domain Family
DCase

?
cd07569: DCase 
Click on image for an interactive view with Cn3D
N-carbamyl-D-amino acid amidohydrolase (DCase, class 6 nitrilases)
DCase hydrolyses N-carbamyl-D-amino acids to produce D-amino acids. It is an important biocatalyst in the pharmaceutical industry, producing useful D-amino acids for example in the preparation of beta-lactam antibiotics. This subgroup belongs to a larger nitrilase superfamily comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to class 6. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer. Agrobacterium radiobacter DCase forms a tetramer (dimer of dimers). Some DCases may form trimers.
Statistics
?
PSSM-Id: 143593
View PSSM: cd07569
Aligned: 20 rows
Threshold Bit Score: 470.638
Threshold Setting Gi: 151413397
Created: 21-Apr-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 15 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Structure:1UF8_A, Agrobacterium sp., DCase (C171aV236A mutant) dimer bound with N-carbamyl-D-phenylalanine; contacts defined at 4A.
    View structure with Cn3D
  • Comment:Agrobacterium radiobacter DCase is a tetramer (dimer of dimers) having four active sites, two per dimer. All but one of the active site residues comes from one of the two participating monomers; the remaining residue comes from the it#s partner monomer.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                     #     #                            
1UF8_A         1 TRQMILAVGQQGPIARAETREQVVVRLLDMLTKAASRGANFIVFPELALTTFFPRWHFt--DEAELDSFYETe--MPGPV 76  Agrobacterium sp.
AAO24770       2 AKNLMLAVAQVGGIDSSESRPEVVARLIALLEEAASQGAELVVFPELTLTTFFPRTWF---EEGDFEEYFDKs--MPNDD 76  Arthrobacter cr...
ZP_02189842    2 SRIINVGAAQLGPIAPDESRVSAVNRMIDLLKQAKDRGVKLVVFPELALTTFFPRYYEq--DISKMDHHFERg-dMPTPE 78  alpha proteobac...
YP_001630941   5 QRKIGLAVAQMGPVHLADTRRAVVARLVEMLREAHARGADLVVFPELALTTFFPRYWMs--DEEAQARFFEAq--MPNAE 80  Bordetella petr...
NP_769970      1 MRIVNVAAAQMGPIQKADSREAVVKRMIALMDEAKAKGADLIVYPELALTTFFPRWYVe--DRAEFDNWFERe--MPSAA 76  Bradyrhizobium ...
ZP_00959048   27 ARKEIFAVAQMGPVHLADTKAQVVARLIDMLREAHGRGARWVTFPELALTTFFPRYIYd--TPEEYDQFFEEg--LPSPA 102 Roseovarius nub...
YP_785207      6 SRIVTVAAAQLGPIQRAEGRESVVARMIRLLERAQQRGAQVVVFPELALTTFFPRWYCe--NRDEADGWFETs--LPSPA 81  Bordetella aviu...
YP_001525648   2 TRVLRLAAAQMGPTSRTEPRAVTLDRMIRLLEAAAADGAQLVVFPELAFTTFFPRWLL---DDAELLASFETa--MPNPG 76  Azorhizobium ca...
XP_001217683   2 SRTVRIAAAQMGTTNSWDKREGTVRRMLALLNDAADKGAQVVLFPETSFTTFFPRYLIl--DEKELDAWFEHgdiRTNPN 79  Aspergillus ter...
XP_774652      2 ARKITVAAAQVGAVHKDSQRPETLSRLISLLEQASQKGVEVLVYPETTFTTFFPRWKGlddDREELDRWFEHgdiTANPN 81  Cryptococcus ne...
Feature 1                                                               #   ##            # #    
1UF8_A        77 VRPLFEKAAELGIGFNLGYAELVVEgg-----vkRRFNTSILV-DKSGKIvGKYRKIHLPGHKEYE-AYRPFQHLEKRYF 149 Agrobacterium sp.
AAO24770      77 VAPLFERAKDLGVGFYLGYAELTSDe--------KRYNTSILV-NKHGDIvGKYRKMHLPGHADNR-EGLPNQHLEKKYF 146 Arthrobacter cr...
ZP_02189842   79 TRPLFEKAKEFGIGFYLGYAELTEGg--------HRFNTSILV-DDTGKIvGKYRKVHLPGHSEYD-GKRPWQHLEKRYF 148 alpha proteobac...
YP_001630941  81 VQPLFDEARRLGVGFYLGYAELTPEg--------VPYNTAILV-DRGARIvGKYRKVHLPGHDDHK-PQAPFQHLEKKFF 150 Bordetella petr...
NP_769970     77 TKPLFERAAQHQMAMNFGYAELTPDg--------HHFNTAILT-DKSGRIvGKYRKIHLPGHVEYD-TKRSHQHLEKRYF 146 Bradyrhizobium ...
ZP_00959048  103 MQPLFEVARDLGVGFYLGYAEKTEDag-----qtRRFNTSVLV-GPDGALlGKYRKIHLPGTVDPI-GDLEFEHLEKRYF 175 Roseovarius nub...
YP_785207     82 TQPLFDAIKRYGLMVYLGYAELAWEpdeqgvvrkRRFNTSVVI-APNGEIvFKYRKVHLPGQAEFA-PYRKVQHLEKRYF 159 Bordetella aviu...
YP_001525648  77 VQPLFDRARALGVGFYVGYAELTPAg--------QRFNSSITV-GPDGAIlGKYRKVHLPGSVEPR-PGDRFQQLEKRYF 146 Azorhizobium ca...
XP_001217683  80 TKALFDFAHERGVDISVGFAEATDDg--------EHYNTCVYYhAATGSIlSKYRKIHLPGDVEPLpDPTAVNQLEKRYF 151 Aspergillus ter...
XP_774652     82 IAPLISRAKDLGIDIVIGYGEKTDDs--------HYYNTCSYI-HAGKEI-SKYRKVHLPGNKEPYpDPEFIDQLEKRYF 151 Cryptococcus ne...
Feature 1                                      ## ##                    ##   #                   
1UF8_A       150 EPGDlGFPVYDVd---------AAKMGMFIANDRRWPEAWRVMGLRGAEIICGGYNTPTHNPP---------VPQHDHLT 211 Agrobacterium sp.
AAO24770     147 REGDlGFGVFDFh---------GVQVGMCLCNDRRWPEVYRSLALQGAELVVLGYNTPDFVPG---------WQEEPHAK 208 Arthrobacter cr...
ZP_02189842  149 EPGDlGFNVWRSm---------GGIMGMCICNDRRWPETYRVMSLKGVEIVMLGYNTPDVNTS---------APEPNHLR 210 alpha proteobac...
YP_001630941 151 QVGDqPFGVWDTm---------GTKIGMCLCNDRRWPETWRVMSLQSAELVVLGYNTPSVNIH---------WPEPVHLR 212 Bordetella petr...
NP_769970    147 EPGDlGFKVWREl---------GGIIGMAICNDRRWPETYRVMGLQGVEMVLIGYNTPSVNAEk--------SEEGVEKR 209 Bradyrhizobium ...
ZP_00959048  176 EVGDlGFPTFATp---------SGRFGMCICNDRRWPETFRVMALRGAEVFMLGYNTPTRNIH---------HPEPAHLR 237 Roseovarius nub...
YP_785207    160 EVGNlGFPVVRTpva----pglEVNMGMLICNDRRWPEAWRVLGLQQVELVMVGYNTPSLNHEn-------qGFEAHHLR 228 Bordetella aviu...
YP_001525648 147 EYGDlGFPAFRGpqa-----wqSPILGMLVCNDRRWPEAWRAYGLQGVELMLMGYNSAAYDPNg-------gNTEDAALR 214 Azorhizobium ca...
XP_001217683 152 KPGNlGFNAFRVpglis-egetDPIMGMMICNDRRWAESWRVLGLQGVEVVLCGYNTNGYAPQfwglsadmdPKEAEEMS 230 Aspergillus ter...
XP_774652    152 EPGDyGFKAFRVpdlavtpedgEAIAGMMICNDRRWAESWRCLGLQGVELVCLGYNTSTWAPGlfghskdadPEVIKAQS 231 Cryptococcus ne...
Feature 1                                                                                  #     
1UF8_A       212 SFHHLLSMQAGSYQNGAWSAAAGKAGMEE-NCMLLGHSCIVAPTGEIVALTTTLEDEVITAAVDLDRCRELREHIFNFKQ 290 Agrobacterium sp.
AAO24770     209 MFTHLLSLQAGAYQNSVFVAAAGKSGFED-GHHMIGGSAVAAPSGEILAKAAGEGDEVVVVKADIDMGKPYKESVFDFAA 287 Arthrobacter cr...
ZP_02189842  211 MFHNHLVMQASAYQNSCFVVATAKAGIED-GCMLIGGSCIIQPSGEIVSLATTVQDELITSACDLDLAKMGKETVFNFAK 289 alpha proteobac...
YP_001630941 213 MHHHLITLQASAYQNCVWAAAAAKCGAED-GHHMIGGSVIVAPTGEIAAQASTEDDEVITVSADLGLAETFRRHVFDFAR 291 Bordetella petr...
NP_769970    210 LFHNRLSVQAGAYQNATWVVAVAKAGNED-GHPLFGGSLIVDPNGEIVAEAKTDDDEVLVHACDLDATTFGKTTIFDFAR 288 Bradyrhizobium ...
ZP_00959048  238 EFHNRLSLESAAYQNGAWVMAAAKCGSED-GFAMIGGSAIVAPTGEVVARAVSEEDEVISYDCDLDLGAYIRRSVFDFAR 316 Roseovarius nub...
YP_785207    229 VQNSQLSVQAGCYQNATFGVSVAKAGKED-GHELFGHSIIVNPQGEVIALAASWDDELVVADCNLAMCDLGRNTLFNFAK 307 Bordetella aviu...
YP_001525648 215 TFHSTLVAQANAYMNATWAVSVAKAGDED-GSALIGGSCIVDPNGVLVAQAKTLEDEVLVADCDLDACRQGKEKMFNFAA 293 Azorhizobium ca...
XP_001217683 231 LFHHRLVMQCHSYTNATFSVSAARCGLDDgKYPLIAGSMIVDPEGRILAESTTVADEVIIADCDLLLCRPGKQRTFDFAR 310 Aspergillus ter...
XP_774652    232 EFQHLLVMQAHSYTNATFSIAAARAGFDDgKFGLIGCSCIVHPEGHIIAQSKTMDDELVIATIDLDDAKIGKQKVFNFGL 311 Cryptococcus ne...
Feature 1                    
1UF8_A       291 HRQPQHYGLIAE 302 Agrobacterium sp.
AAO24770     288 HRRPDAYGIIAE 299 Arthrobacter crystallopoietes
ZP_02189842  290 HRRIEHYGIITS 301 alpha proteobacterium BAL199
YP_001630941 292 HRRPEHYRLIVE 303 Bordetella petrii DSM 12804
NP_769970    289 HRRIEHYGLITS 300 Bradyrhizobium japonicum USDA 110
ZP_00959048  317 HRRIEHYGPITD 328 Roseovarius nubinhibens ISM
YP_785207    308 HRRPEAYSRIVE 319 Bordetella avium 197N
YP_001525648 294 HRRPEHYRRLVD 305 Azorhizobium caulinodans ORS 571
XP_001217683 311 HRRVEHYGRILS 322 Aspergillus terreus NIH2624
XP_774652    312 HRQPHQYSIITQ 323 Cryptococcus neoformans var. neoformans B-3501A

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap