Conserved Protein Domain Family

cd07563: Peptidase_S41_IRBP 
Click on image for an interactive view with Cn3D
Interphotoreceptor retinoid-binding protein; serine protease family S41.
Interphotoreceptor retinoid-binding protein (IRBP) is a homolog of the S41 protease, C-terminal processing peptidase (CTPase) family. It is thought to facilitate the compartmentalization of the visual cycle that requires poorly soluble and potentially toxic retinoids to cross the aqueous subretinal space between the photoreceptors and the retinal pigment epithelium (RPE). IRBP is secreted by photoreceptors into the interphotoreceptor matrix (IPM) where it is rapidly turned over by a combination of RPE and photoreceptor endocytosis. It is the most abundant soluble protein component of the IPM, consisting of homologous modules, each repeat structure arising through the duplication (as in teleost IRBP) or quadruplication (in tetrapods) of an ancient gene, arisen in the early evolution of the vertebrate eye. IRBP has been shown to promote the release of all-trans retinol from photoreceptors and facilitates its delivery to the RPE. Conversely, IRBP can promote the release of 11-cis-retinal from the RPE, prevent its isomerization in the subretinal space, and transfer it to photoreceptors. In vivo evidence implicates IRBP as a retinoid transporter in the visual cycle, suggesting a critical role for IRBP in cone function essential for human vision. IRBP is a dominant autoimmune antigen in the eye; IRBP proteolysis analysis has proven a useful biomarker for autoimmune uveitis (AU) disorders, a major cause of blindness. This family also includes a chlamydia-secreted protein, designated chlamydia protease-like activity factor (CPAF), known to degrade host proteins, enabling Chlamydia to evade host defenses and replicate.
PSSM-Id: 143479
Aligned: 65 rows
Threshold Bit Score: 122.786
Threshold Setting Gi: 219852797
Created: 29-Apr-2009
Updated: 2-Oct-2020
Aligned Rows:
active site
Conserved site includes 3 residues -Click on image for an interactive view with Cn3D
Feature 1:active site triad [active site]
  • Comment:Active site residues are inferred for IRBP from CPAF
  • Comment:Mutations of catalytic triad abolish CPAF autocleavage and proteolytic activity.
  • Structure:3DJA: Chlamydia trachomatis secreted protease CPAF
    View structure with Cn3D

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                            #           
1J7X_A         7 VLHQLCDILANNYAfser-----iptLLQHLPNldys--------tvisEEDIAAKLNYELQslteDPRLVLKSktdtlv 73  African clawed ...
3DJA_A        12 DLSFLEHLLQVKYApktwkeqylgwdLVQSSVSaqqklr----tqenpsTSFCQQVLADFIGgl-nDFHAGVTFfaiesa 86  Chlamydia trach...
Q9Z6P3        34 DLNVIEHLISLKYAplpwkellfgwdLSQQTQQarlqlv----leekptTNYCQKVLSNYVRsl-nDYHAGITFyrtesa 108 Chlamydophila p...
YP_007915     38 DLKMIKHAFDVGYAplewkk-nytglNLDEELNksidlil---snptltHKDFQRIVKNFLAst-kDYHVDVIFfsteta 112 Candidatus Prot...
YP_878916     45 DFNYMYNILKENYPyfevn---krqnKVDWLNKkndyism---ikttknDKEFLNTLHNILKel-nNGHTDIMPekfysp 117 Clostridium nov...
YP_001470875 110 YLMNGGKVVPIFVSfddeq--itiltDVEGKLNqpgklislngvsagdlKEEILKMVSFERAsf-gYARASLLFhlycwv 186 Thermotoga lett...
ZP_02068778  160 NGLPYKQWIEQNEKyte------astVPHRRLRtay-----------daFRSYADTLRNYTLlr-gGDTLTVTLplkqrd 221 Bacteroides uni...
YP_001918632  54 DFKYMYNIMKENYVnlydi--dtdwlDMKAHFKasvk--------dtddNYEFYQQMYNSLRvi-dDLHLGIYDpkmfys 122 Natranaerobius ...
ZP_03850560  119 DHEKLYSSANTGQIpagsailsingqDIESLFQnmkknig--gtsqfrdIISLKLFSYFLYLen-iTAPFSVKYklpegd 195 Chryseobacteriu...
ZP_03916251   97 DFEYLFKELKESYPffgvl---krkyEVDFLKNhdaylkk---vracknDGEFIKVLNEVMAdl-hNYHAKIADsayvdq 169 Anaerococcus la...
Feature 1                                                                                        
1J7X_A        74 xpgdsiqaeniped------------------------------------------------------------------ 87  African clawed ...
3DJA_A        87 ylpytvqkssdgrfyfvdixtfsseirvgdellevdgapvqdvlatlygsnhkgtaaeesaalrtlfsrxaslghkvpsg 166 Chlamydia trach...
Q9Z6P3       109 yipyvlklsedghvfvvdvqtsqgdiylgdeilevdgmgireaieslrfgrgsatdysaavrsltsrsaafgdavpsgia 188 Chlamydophila p...
YP_007915    113 tlpfdvkgvnnryfitwidelklppstytikvgdeiiefdgrplgdvieelkqhgsknsnpltdqalaeikltnrlgwlg 192 Candidatus Prot...
YP_878916    118 faslytertdlnkawldelnkpkslery---------------------------------------------------- 145 Clostridium nov...
YP_001470875 187 ifgeqesftvefltqqgqlqkiel-------------------------------------------------------- 210 Thermotoga lett...
ZP_02068778  222 yfpdne-------------------------------------------------------------------------- 227 Bacteroides uni...
YP_001918632 123 kelgsgeiikfadkkyhgwkevfneeg----------------------------------------------------- 149 Natranaerobius ...
ZP_03850560  196 ireitinegmkfrdf----------------------------------------------------------------- 210 Chryseobacteriu...
ZP_03916251  170 tlkyysqnwnqpsiyyeflnlnrqvvrnryg------------------------------------------------- 200 Anaerococcus la...
Feature 1                                                                                        
1J7X_A           --------------------------------------------------------------------------------     African clawed ...
3DJA_A       167 rttlkirrpfgttrevrvkwryvpegvgdlatiapsirapqlqksmrsffpkkddafhrssslfyspmvphfwaelrnhy 246 Chlamydia trach...
Q9Z6P3       189 mlklrrpsglirstpvrwrytpehigdfslvaplipehkpqlptqscvlfrsgvnsqssssslfssymvpyfweelrvqn 268 Chlamydophila p...
YP_007915    193 diipqgpvtikvhsrsk--------evplsyqliwdyrpelifspsfflqtvesffpnkkisvrspcmtmmnlthrkmms 264 Candidatus Prot...
YP_878916        --------------------------------------------------------------------------------     Clostridium nov...
YP_001470875     --------------------------------------------------------------------------------     Thermotoga lett...
ZP_02068778      --------------------------------------------------------------------------------     Bacteroides uni...
YP_001918632     --------------------------------------------------------------------------------     Natranaerobius ...
ZP_03850560      --------------------------------------------------------------------------------     Chryseobacteriu...
ZP_03916251      --------------------------------------------------------------------------------     Anaerococcus la...
Feature 1                                                                                        
1J7X_A        88 ----------------------------eaxlqalvntvfkvsilpgnIGYLRFdqfadvs---------viaklaPFIV 130 African clawed ...
3DJA_A       247 atsglksgynigstdgflpvigpviweseglfrayissvtdgdgkshkVGFLRIptyswqdxe----dfdpsgpppWEEF 322 Chlamydia trach...
Q9Z6P3       269 kqrfdsnhhigsrngflptfgpilweqdkgpyrsyifkakdsqgnphrIGFLRIssyvwtdlegleedhkdspwelFGEI 348 Chlamydophila p...
YP_007915    265 etkrdgtlcarksfiptlgprvwmfdkidkekeiswyayiykiseeekIGYIRIphyigy----------keeskeFGEL 334 Candidatus Prot...
YP_878916    146 ---------------sanndninkktnpniykkptannfrteilekdkVAYLYIksfnyyn--------idsdgkmIYKF 202 Clostridium nov...
YP_001470875 211 -------------------esvdfekyrakreqmnmsgklwdfsiidkTAVMTIntfssay--------ekdlkqfIKQS 263 Thermotoga lett...
ZP_02068778  228 ------------------------------------eqtvesrilqdsIGYLTIktmmn------------pvmedFKAV 259 Bacteroides uni...
YP_001918632 150 ---------------ydidpeqlrdeekekryeggaanidteiieedqIAYLHInsfei------------dsseeIRNF 202 Natranaerobius ...
ZP_03850560  211 ----------------------------lalsmpgiakpydfkiinhkLAYLDFrsmsgnm---------ddfdkfLSET 253 Chryseobacteriu...
ZP_03916251  201 ------------legvqsqsasasvkrkqekkskgdskanisledhgdLAILKIsqmgdmn--------nekdqkvLDEF 260 Anaerococcus la...
Feature 1                                                                                        
1J7X_A       131 NTVWEpit-iteNLIIDLRyNVGGss-taVPLLLSYFldpetKIHLFTLHnrqqnstdevysh----------------- 191 African clawed ...
3DJA_A       323 AKIIQvfssnteALIIDQTnNPGGsv-lyLYALLSXLtd--rPLELPKHRxiltqdevvdaldwltllenvdtnvesrla 399 Chlamydia trach...
Q9Z6P3       349 IDHLEke---tdALIIDQThNPGGsv-fyLYSLLSMLtd--hPLDTPKHRmiftqdevssalhwqdlledvftdeqavav 422 Chlamydophila p...
YP_007915    335 LNYLEqk---tdALVIDQVhNGGGya-sfQYELASMLal--nPLKTPKHQmkitqkdvltayqildviekiqqgiddeie 408 Candidatus Prot...
YP_878916    203 LQKIKdy----kVLIIDIRnNGGGsdnywQENIVSPLln--kTVVYNTYLafrggkfsenfienrfnkkydsldniskik 276 Clostridium nov...
YP_001470875 264 FEQIKked--iqNLIIDLRkNGGGss-eiGEYLYSFIsn--kPYRVYAEIhvkysddavktlkifdplllfrvkv----- 333 Thermotoga lett...
ZP_02068778  260 YPKVKdl----pYLIIDVRrNGGGns-mnGVNICKYFir--eAQPHCVSKsyimqpe----------------------- 309 Bacteroides uni...
YP_001918632 203 MEEISdy----pYLIIDIRgNLGGqr-ywKDVFHNLEev--dYKSYLFSKggdlanyflehkvsedyniddikeypgyed 275 Natranaerobius ...
ZP_03850560  254 FSTIRken--ikDLAIDLRnNSGGns-ilGDLLLSYItd--qKYSLQGSKrwkisqiykdkliadhnteseylkme---- 324 Chryseobacteriu...
ZP_03916251  261 LRNKHmy----kALVIDIRnNVGGnmeywQSFLLPKLtk--nPKQVINHMffkdsaktrlllqdntlnmenlsnvditgi 334 Anaerococcus la...
Feature 1                                                                             #          
1J7X_A       192 ----------------------------------------------pkvlgkpygskkGVYVLTShqtaTAAEEFAYLXQ 225 African clawed ...
3DJA_A       400 lgdnxegytvdlqvaeylksfgrqvlncwskgdielstpiplfgfekihphprvqyskPICVLINeqdfSCADFFPVVLK 479 Chlamydia trach...
Q9Z6P3       423 lgetmegycmdmhavaslqnfsqsvlsswvsgdinlskpmpllgfaqvrphpkhqytkPLFMLIDeddfSCGDLAPAILK 502 Chlamydophila p...
YP_007915    409 egpidyqhllf-------lkafyeftiqewdgqrtltdpthlegcdwinphsdyrytkPILMLINeldfSGGDFMPAIMQ 481 Candidatus Prot...
YP_878916    277 een-----------------------lsntppelenkfkyykkdvyiihpqypigfkgKIYLITNkkvfSASEAFSVFAQ 333 Clostridium nov...
YP_001470875 334 ----------------------------------lnqkiivhrndfkkvrrndllfnkNVYVLVGpgtfSAAADFAAMVK 379 Thermotoga lett...
ZP_02068778  310 ----------------------------------------------------adaykgKIYLLTDtytlSAAESFTLDMK 337 Bacteroides uni...
YP_001918632 276 -----------------------------lpdhiqenfedyiwkektiepedpldfsgEIFILTDrnvySSSDRLVNFAR 326 Natranaerobius ...
ZP_03850560  325 ---------------------------------ngtvwetgnckpdfnkfkndpvfkgKVYVLTGpftfSSANLVADGMK 371 Chryseobacteriu...
ZP_03916251  335 rl------------------------dhaedlkdfayyikdtitinpdetkrdngyegPIFLLVDenvfSAAEGFASFIK 390 Anaerococcus la...
Feature 1                                                             #                          
1J7X_A       226 SlsRATIIGEITSGNLx---hSKVFPFGd--tQLSVTVPi-INFIDSn-GDYWLGGGVVPDAIVLa------------DE 286 African clawed ...
3DJA_A       480 DndRALIVGTRTAGAGg---fVFNVQFPnrtgIKTCSLTg-SLAVREh-GAFIENIGVEPHIDLPftandi--rykgySE 552 Chlamydia trach...
Q9Z6P3       503 DngRATLIGKPTAGAGg---fVFQVTFPnrsgIKGLSLTg-SLAVRKd-GEFIENLGVAPHIDLGftsrdl--qtsrfTD 575 Chlamydophila p...
YP_007915    482 DnqRAVLFGTRTSGAGg---fVLQASFPnnngIAAFSYTg-SIAERPetLLKIENLGVTPDIVYSltvddlqngyqgyKA 557 Candidatus Prot...
YP_878916    334 StgFATLIGEPTGGDGig-fdPAICSLPn--sGYIFRFPl-DLGMISd-GTCNFEHKTIPDIKCNpkmhv----nirrDE 404 Clostridium nov...
YP_001470875 380 DlkAATVVGEETGGLAssygdVLSFILPn--sKLQLGVSf-KYFVRC--GGFDDKRGVIPDIAVQipitdd--tdqlvRT 452 Thermotoga lett...
ZP_02068778  338 EsgNVTLIGEATGGDTg----NGPRPFCtk-qRTYFRIPtrQPDVSSk-GFPMEGIGIPPHHQVSqtvad---fmkdeDT 408 Bacteroides uni...
YP_001918632 327 KtdLATVVGTRTRGGGmngppRLFYSLPn--sGLLIEFEg-FLGLNA--DGKNSYVGTEPDIEVEtqth-----qeliDE 396 Natranaerobius ...
ZP_03850560  372 QykLAELVGEPTGEYTndfgeAFMFTLPn--sKIQMRSTs-SMSFGAd-CNTSSYTPVVPDILIVptlqd---kingiDK 444 Chryseobacteriu...
ZP_03916251  391 HteFATIVGTQTGGDGit-lgVINSVLPn--sGLVFTYTn-TLGYDPs-GEINEEDPTKPDIESAs-----------yRQ 454 Anaerococcus la...
Feature 1             
1J7X_A       287 ALDKA 291 African clawed frog
3DJA_A       553 YLDKV 557 Chlamydia trachomatis
Q9Z6P3       576 YVEAV 580 Chlamydophila pneumoniae
YP_007915    558 AVNEA 562 Candidatus Protochlamydia amoebophila UWE25
YP_878916    405 PIKYI 409 Clostridium novyi NT
YP_001470875 453 VLEAV 457 Thermotoga lettingae TMO
ZP_02068778  409 VLNYA 413 Bacteroides uniformis ATCC 8492
YP_001918632 397 TVEII 401 Natranaerobius thermophilus JW/NM-WN-LF
ZP_03850560  445 PLEYI 449 Chryseobacterium gleum ATCC 35910
ZP_03916251  455 SIETI 459 Anaerococcus lactolyticus ATCC 51172

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap