
Conserved Protein Domain Family

cd07562: Peptidase_S41_TRI 
Click on image for an interactive view with Cn3D
Tricorn protease; serine protease family S41
The tricorn protease (TRI), a member of the S41 peptidase family and named for its tricorn-like shape, exists only in some archaea and eubacteria. It has been shown to act as a carboxypeptidase, involved in the degradation of proteasomal products to preferentially yield di- and tripeptides, with subsequent and final degradations to free amino acid residues by tricorn interacting factors, F1, F2 and F3. Tricorn is a hexameric D3-symmetric protease of 720kD, and can self-associate further into a giant icosahedral capsid structure containing twenty copies of the complex. Each tricorn peptidase monomer consists of five structural domains: a six-bladed beta-propeller and a seven-bladed beta-propeller that limit access to the active site, the two domains (C1 and C2) that carry the active site residues, and a PDZ-like domain (proposed to be important for substrate recognition) between the C1 and C2 domains. The active site tetrad residues are distributed between the C1 and C2 domains, with serine and histidine on C1 and serine and glutamate on C2.
PSSM-Id: 143478
Aligned: 79 rows
Threshold Bit Score: 117.301
Threshold Setting Gi: 226357161
Created: 24-Aug-2008
Updated: 2-Oct-2020
Aligned Rows:
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:Active site tetrad [active site]

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                       ##                
ZP_01105250   353 FRLLTLFKYWNIVNYFSPNkh-lTDKNWDEVLTEYIPKFids-knELEYELTTLKLIGEIsdSHARIGLggqkindlrgn 430  Flavobacteria...
YP_822135      27 ANVEAFEKVWSTIRDKHWDpk-lGGVDWQATHDELRPKVeaa-ksDAAVREILNEMVGRLkqTHFGIFPgdvyhdldasg 104  Solibacter us...
YP_822875     352 FQMLALFRYWNIIEYWFPNrd-iIGENWDDVLKQTLPKIvla-kdRDTYQLEMMALIARIhdSHANLWSslalrppvgac 429  Solibacter us...
YP_001095926  349 FRLLALYRYWNIVQYFFPYky-lTDKEWSGVLAEYLPLFlga-knRLDYEKVTLSLIAELkdTHANLWAgrgevekmrge 426  Shewanella lo...
ZP_01856613   223 VGAEIFDKVWNAFDREYAMfvikPEVDWQKLRDQFRPQAvla-knNRELANVLSEMLAHLkdLHVYVQVdgtyvkgfnr- 300  Planctomyces ...
ZP_01908243    65 AHVPAFDEVWKTVANKHFDpt-lGCLDWPALRETYGAKVaeagddTAAAYAAINELLGLLgqSHLAATPpaadpidatpq 143  Plesiocystis ...
ZP_02162210   354 FRLLTLYRYWNMIHYYFPYky-lTDKDWSTVLKEYIPTFina-stELEYEIAALRLIGDIqdTHAGLWGgndkfqailgs 431  Kordia algici...
YP_002760585   41 AFIDQFDALWTRFDDVYPSfa-yKRVDWNAQRARYRPRAera-rsQDELVAVLIEMLAPLhdRHVWLVDprgqavptyra 118  Gemmatimonas ...
YP_002760614   71 NPVATFDTAWSIIRRTHWDtt-yNGVNWLALREELRPRAaaa-htRGELRLVLSEMVGRLrqSHFAIIPqeladndrsad 148  Gemmatimonas ...
Feature 1                                                                                         
1N6E_I        763 griacdfkldgdhyvvakayagdysnegekspifeygidptg---------------------------------ylied 809  Thermoplasma ...
ZP_01105250   431 yyppfevrfiqgklvvtnyhnpelikesgleigdvithiqerave---------------------------svidslkp 483  Flavobacteria...
YP_822135     105 ehdsgdadigidlrvidgralvtevypaspagakgvkpgwailrigahdv------------------apvvsrireqfa 166  Solibacter us...
YP_822875     430 qlpvnlrfvenqavvtgysaeamentsglkvgdviadldgvpvak----------------------------lvqtwtp 481  Solibacter us...
YP_001095926  427 fyppvftrfvegelvvvdfytdnesnisdmsrlgglsigdviteidgv---------------------aveklvkdklr 485  Shewanella lo...
ZP_01856613       --------------------------------------------------------------------------------      Planctomyces ...
ZP_01908243   144 gpavvpiavrwlpvepkseeravvivdaeldghdsglprgavltrigdepvatitervsarihehggsqaevaftiarsv 223  Plesiocystis ...
ZP_02162210   432 ntapfkvafvenklvvtkyynpeykevskvkigdvithingktv-----------------------------eeikker 482  Kordia algici...
YP_002760585  119 n------------------------------------------------------------------------------- 119  Gemmatimonas ...
YP_002760614  149 tttagqparggggslgwrfryldgamvltgvdsggpawaagvragwtvqavd--------------gcplaprlaalpdd 214  Gemmatimonas ...
Feature 1                                                                                         
1N6E_I        810 idgetvgagsniyrvlsekagtsarirlsgkggdkrdlmidildddrfIRYRSWVEANRRYVHERSk------------- 876  Thermoplasma ...
ZP_01105250   484 yypasndaarmrdisldilrsreknlsigyisedkkiqeviklfpkdsLDIVRWDVSDGKPSHKFId------------- 550  Flavobacteria...
YP_822135     167 dsslldlrlnravvtrlqgsegsavmvefldgsnrkiavdlvraaprgKLARLGNLPPTPTWSEWRrl------------ 234  Solibacter us...
YP_822875     482 yyaasneptrlrdiarsmtrgecgaaklrvfrgtqevtlqsdrvplgsLKFSSSHDRPGETYQRLS-------------- 547  Solibacter us...
YP_001095926  486 yypasneasrlrdiapdllrsnkaeidisfrrdklmgntslklfkkdeLDYFYLYRKPKGEKSYKNi------------- 552  Shewanella lo...
ZP_01856613   301 ---------------------------------------erqfnaspaAAAHLIGKINQVKGMRWGrt------------ 329  Planctomyces ...
ZP_01908243   224 gvmlgcpengtksltftadgeertvdapcfvpegerislgnlrdlptrVSWRMVGESSPSPAPDEGgeagetggppepap 303  Plesiocystis ...
ZP_02162210   483 hdyhpasneptkdrnmaksmlrspnkeiaityvsdgktqqhtlplygfRDLNIYAKSNKASYKLLD-------------- 548  Kordia algici...
YP_002760585  120 -------------------------------------altnfdrarweAAMRDASIVRRNEIGEGLv------------- 149  Gemmatimonas ...
YP_002760614  215 pdprhvalrafqlasrlldggegdriavsltdgkhrlqthtltfaaapGTVTKFGNLPPMVAHLEWervr---------- 284  Gemmatimonas ...
Feature 1                                                                                         
1N6E_I        877 -------GTIGYIHIpdm----gmMGLNEFYRLFINess-yqGLIVDVRF--NGGGf-------VSQLIIEKLMnk---- 931  Thermoplasma ...
ZP_01105250   551 -------DNIGYITLrsl----ekKDIENIKTKFRNt----kGIIIDIRNypNTFVpy-----sLGPYFVSSTRpfv--- 607  Flavobacteria...
YP_822135     235 ------pQDIGYVRFnif---ldpDGLAKTMEEAMKgcrdcrGFVLDLRG--NPGGiggl-amgVAGWFTDKSGqq---- 298  Solibacter us...
YP_822875     548 -------SEVAYIKMssi----knVDIPRYIDSAAGt----kGLIIDIRN--YPSDfvv---ftLGQLLVTEKTefv--- 604  Solibacter us...
YP_001095926  553 ------dGDIGYVTLati----ekEDVDSIKNQFKDa----aGIIIDIRNypNTPSmy-----sLGSFFVEDKSaf---- 609  Shewanella lo...
ZP_01856613   330 ------eDDIGYIAVdslsketllNQFESALKQMQGt----rGLVLDIRA--NGGGaepl-gqkMAGYFLDQPCl----- 391  Planctomyces ...
ZP_01908243   304 apdsnsnAKIGYLAFnywm-lpmvERIREGIKQMRAsg--meALILDLRG--NPGGvgam-svpVARLFVDRPVs----- 372  Plesiocystis ...
ZP_02162210   549 -------NNIGYVTLeti----svDDISKIKKQFKKt----kGIIIDIRN--YPAEsil---yyLGSYFVSEPTefv--- 605  Kordia algici...
YP_002760585  150 -------GGYAYLYIgtwrapvdiDALDLALERARDa----qGLIIDLRT--NAGGsd-----gTAMAFAGRFTrra--- 208  Gemmatimonas ...
YP_002760614  285 ----qggRTVGVIRFntwm-pvlsAQFDAAIDSLRSa----dAIVLDVRG--NLGGvggmsmgfAGHFVDTVLTlgtmhq 353  Gemmatimonas ...
Feature 1                                                                 #                       
1N6E_I        932 ----riGYDNPRr----------GTLSPYPtns---------vrGKIIAITNEyagSDGDIFSFSFKKlgLGKLIGT-RT 987  Thermoplasma ...
ZP_01105250   608 ---kltAANIDNpge-----icfVKELEVPksnd-------aysGKLIVLVNEysqSQSEFTCMALRVgdNTTIVGS-TT 671  Flavobacteria...
YP_822135     299 -----lGTEYLRgm--------tLKFVIFPrpr--------pflGPLAVLVDGcsaSTSEILAGGLKDigRARLFGT-RT 356  Solibacter us...
YP_822875     605 ---rftSGDLANpgafh-wgpplALNPQKPhy-----------aGKVVILVDEvsqSNAEYTTMAFRSatGATVIGS-TT 668  Solibacter us...
YP_001095926  610 -----aKFTYPNinnpg-efgvgNVAVLKPsev--------tfkGKLVVLVNEntqSQAEFTAMAFRAgrDTTIIGS-KT 674  Shewanella lo...
ZP_01856613   392 -----yATHQYRsgpkhddlgsmQKRRLIPsqdw-------yyrGPVIVLQGEktmSSAEAFALMLAEcpTVTTMGD-RT 458  Planctomyces ...
ZP_01908243   373 -----lGRLQMRdfn------qeFKVDANPda----------faGPIVVLVDEgtaSTSEIFALGMADvgRVTVIGAgPS 431  Plesiocystis ...
ZP_02162210   606 ----kfSRMNEKn---------pGEFVMTEayeisk--srsmykGKLVVLVNEasqSHAEFTAMAFRAgeNTTIVGS-TT 669  Kordia algici...
YP_002760585  209 ---fpaSYVEIRtd-------prVTDVEMPlartiaprgpwqftRPVVLITGRgglSATESFAAAMRTlpQVTVIGD-TT 277  Gemmatimonas ...
YP_002760614  354 rgatlrMVTNPRrv-------dtRARAVKPf------------aGPLALVVDElsaSTTEIFAGGLQGhrRATVFGT-RT 413  Gemmatimonas ...
Feature 1                                             #                                   
ZP_01105250   672 AGADG-NVSSISLpGGISTRISg-MGIYYPDgt-etQRVGIEPD-VESKPTIqgiknGRDEVLEKAIELINE 739  Flavobacteriales bact...
ZP_01908243   432 AGMAL-PSLIETLpDGGLIQYV--VGDYHSTkgtaaEGEGVPLD-ARVEESRvdyaaGRDPVYDAAVAHLEA 499  Plesiocystis pacifica...
YP_002760585  278 GGASG-NPATFALgNGWQFTVPr-WLEYGPDrq-piEGRGVAPH-LAMAWDPasydsMRDPLIDAAVGLLGE 345  Gemmatimonas aurantia...
YP_002760614  414 AGQAL-PSVPERLpNGDILYHA--IADFVGPtgtpvEGAGVLPDhVTPPTARal-veGRDPALQAALHWAAT 481  Gemmatimonas aurantia...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap