Conserved Protein Domain Family

cd07561: Peptidase_S41_CPP_like 
C-terminal processing peptidase-like; serine protease family S41
Bacterial protease homologs of the S41 family related to C-terminal processing peptidase (CPP). CPP-1 is believed to be important for the degradation of incorrectly synthesized proteins as well as protection from thermal and osmotic stresses. CPP is synthesized with an extension on its carboxyl-terminus and specifically recognizes a C-terminal tripeptide, but cleaves at variable distance from the C-terminus. The CPP active site consists of a serine/lysine catalytic dyad. Conservation of these residues is seen in the CPP-like proteins of this group. CPP proteins contain a PDZ domain that promotes protein-protein interactions and is important for substrate recognition however, most of CPP-like proteins only have an internal fragment or lack the PDZ domain.
PSSM-Id: 143477
Aligned: 33 rows
Threshold Bit Score: 167.431
Created: 26-Jun-2009
Updated: 2-Oct-2020
Aligned Rows:
Catalytic dyad
Feature 1:Catalytic dyad [active site]

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
YP_861128     37 VEQTLELEIKNFEYEAMdiWYLYKDEipeynddffanqeelnvwldefdsPESLFYDGLVYQyev------vdeFSWIVD 110 Gramella forset...
YP_001558305 535 CLKYALITEDQFNNYEIs-WYIGNVYsrlsdseqale--hykmalekneeDADLLTDIGWEYyyte----eftdASLYAD 607 Clostridium phy...
ZP_01863897   63 LYPDLLNTSVNKADYTTlqGYLNAVTapgqalf-----------npdglpSKTFTYITSIEEenelinsgsnagFGIRLT 131 Erythrobacter s...
ZP_01626544   40 YDVCGEESKKAFVSSVAesWYLWYEElaevep-------------edfdtAQAYLDALTAPLapdg----rdpgFSYLTD 102 marine gamma pr...
ZP_01905797   38 SDCTAVEAQNQFVVDVMrqNYLWSDSvpedvd------------itayedPSDLVRELRDENd----------rWTRISD 95  Plesiocystis pa...
YP_001610806  35 KADCSLQGHNQFLFELMkdAYLWYDGvpdldy-------------raypsPEALLVDLVTEPrd---------rWSYIST 92  Sorangium cellu...
YP_002660780  43 IDSCGVESQKDFVLAVAqdWYLWYDEmaevdp-------------gdyssAEQYLSALTAPLaedf----rdpgFSFLTT 105 gamma proteobac...
ZP_01043012   36 FASCSFADQNQRFFEYMqeDYFWNDSlpqtie------------peayddVYQLLEELRAPEd----------rYSYILT 93  Idiomarina balt...
ZP_01720231   25 IPNPDSIEVKNAIYDALeeWYYWNQElperpe------------pkgfdsNQEYLEALKFKPld---------rFSYITT 83  Algoriphagus sp...
AAP58520      26 PRNCTRTSQNLFVRDVLdeYYLWYRElprlnp-------------snyatPEAYLDAARFRPld--------stFSYITS 84  uncultured Acid...
Feature 1                                                                                        
YP_861128    111 dyealenrfagvstgtgldyglsryctgcdevlgyvryvipntpaaeagfergmvftei---dgqqitvsnfqtllapet 187 Gramella forset...
YP_001558305 608 kalqldgtnykatnlkkliekrqtnvidqvtefieknymyyksnasydtlkn----------------slianqsekied 671 Clostridium phy...
ZP_01863897  132 ydtlnnrvfvveafengpsflvgfdrgteilqiggqsvsalmasggpgavv-------------------dalgpgdpgv 192 Erythrobacter s...
ZP_01626544  103 kaaddaqgstgayvgfgfsygfdfqnrflfsdvlqggpagdanfqrgnevlaidmgagyetidelserqatiseifggne 182 marine gamma pr...
ZP_01905797   96 kstsdalfmegkfvglgyktqrmeddsirisfvsdnspasmagilrgdrivgaggytv----aeldegglwseaygsndp 171 Plesiocystis pa...
YP_001610806  93 ksvddaffregqtlgfgmrwsfdqegslrlaliqpgspageaglrrgdavvaingid------veqvvsddlweelagpd 166 Sorangium cellu...
YP_002660780 106 eaedeanltsaafvgfgfrfaindtgaylvsdvfedapafragfvrgaqilavdagngyvtmrqyeeqgaslddifggst 185 gamma proteobac...
ZP_01043012   94 qdeydalfvsaeyagfgfsqqqisaervklrfvyqdspawdagmrradeiiaidgvp------vsqllangtyndalgpa 167 Idiomarina balt...
ZP_01720231   84 iedfnnsfvgknaghgfgfafdaneklfltfvyddapagkdgwkrgweiieingkai------seykngagsydfqlgna 157 Algoriphagus sp...
AAP58520      85 raandafygdsqfvgvgittqmsgsemrvlqvfpespaseagmargdrifeingtsv-------telietgliggafgas 157 uncultured Acid...
Feature 1                                                                                        
YP_861128    188 ltfglgeigegdivstdqtitvtkatinenpvhvaktlnvDGIKVGYLMYNSFtad------ydDELNEAFAQFqadGIT 261 Gramella forset...
YP_001558305 672 isklfdsihkdndpfsfilygenykrylkyqsgktveykdVGENINYIRITSFsss------taNEFLDVVDAIentKDK 745 Clostridium phy...
ZP_01863897  193 trsfvirsvsgvqqnasvtkeefsldpisdrygvrvlsdgAGGQVGYINLRTFivq-----dagPQLIDAFQQFrtqGIS 267 Erythrobacter s...
ZP_01626544  183 aglergfrvrqdqsvvevilakreldtpplatepllleraGNSPVGYLNLRSFilt------anDALSDATRLFrdaGVT 256 marine gamma pr...
ZP_01905797  172 gvvveleiehlatgesevltitkdwidivsipvvetfegpDDTTVGYFVMDKFvgt------thDELDAAYAQFkeaGVT 245 Plesiocystis pa...
YP_001610806 167 eegyemsltieradaeaftvalrkawygittvvsprvlqtGSATVGYLMLTTFiep------svSELDSAFALFresQVD 240 Sorangium cellu...
YP_002660780 186 eglergfrlqigsetveltvakeeldvppiaaaprtidrtGLAPVGYIHLRNFtls------arPALTDAFAELadqDIT 259 gamma proteobac...
ZP_01043012  168 esgitrditwrtptgdeqsatitkdevatntvmgqtiwqlDGQSVGYFTLDAFinr------tgNDLNQVFNELdanNID 241 Idiomarina balt...
ZP_01720231  158 eagitnsftfklpdgsttsrsntkaeyqsnsilhqevierGGKKIGYWVYNSFkataglsptqsKEVQESLDFFqdqNIS 237 Algoriphagus sp...
AAP58520     158 epgvtaqvgfqsrqgverratltkrvvtiptvsltrtfqvDGRTVGYLLFRNFvep------syGALDEAFAALreaRAT 231 uncultured Acid...
Feature 1                                                                                        
ZP_01626544  257 DLVIDLRYNGGGlVSVADRMLDLLGGlvatGQDSWSIVHNAk--------HSDEDFGAyfa--kfpDSMRPLRIAFITTG 326 marine gamma pr...
YP_002660780 260 DFAIDLRYNGGGlVNIADLFLDLLGGavanEEVAYRVSHNEkrg----aeNRSYVFGEr------lDSVSPIRIAFITSE 329 gamma proteobac...
Feature 1           #                          #                                                 
YP_861128    341 sSASASELIINGLAPYi--DVEHIGTKTVGKVqASVTLYDaefpytnknrinteHKYALQPlISTSVNAdgn-afpEGLI 417 Gramella forset...
YP_001558305 807 nSASCSELVTLGLKTYl-dNVTVIGRKTFGKGvGQLLFEDk------------tRGFVIFM-VNHYWNVreenimgKGIQ 872 Clostridium phy...
ZP_01863897  337 gTASASELVSNSMIPYlgdNIALVGTDTYGKPvGQNAFDRs------------aCDDRLRAvTFKTVNAngqgdyfGGLA 404 Erythrobacter s...
ZP_01626544  327 gTASASELVINSLSPHi--EVVLIGEDTLGKAvGQYAFDQdrwsa-----ewstCDTRLRLiAFQIVNGegageyyNGLV 399 marine gamma pr...
ZP_01905797  317 rTLSASELVINALFPYv--DVTLVGSTTGGKPvGSRSYEFc-------------EKLLYPV-SFRLVNAdgqsdyfDGLS 380 Plesiocystis pa...
YP_001610806 312 gTASASESLINSLRAYm--DVKIVGSTTHGKPvGMYGWDNc-------------DMVVHPI-AFRVLNAkeegdfyDGLP 375 Sorangium cellu...
YP_002660780 330 sTASASELLINSLEPFv--EVVLVGSDTSGKAvGQYAFDQt------------gCDTRLRLvSFESASGegfggyyTGLV 395 gamma proteobac...
ZP_01043012  314 aSCSSSELVINSLRPHv--DVITIGETSCGKPvGQQPQELc-------------DKVTFAI-NFETVNSegqgqyyDGLS 377 Idiomarina balt...
ZP_01720231  307 gSASASELVINSLNPYf--DITLIGDNTYGKPvGSFPLSNynnt-------lksNNVELVPiTFATANAegnaeyfDGFE 377 Algoriphagus sp...
AAP58520     302 aSASASELLINSLRPHi--PVFVIGDATYGKP-VGQYGFAf-------------CDKVLAPvAFALVNSdgqgdffGGIA 365 uncultured Acid...
Feature 1                               
YP_861128    418 PDIEQQEfi---stYGTLGDPSE 437 Gramella forsetii KT0803
YP_001558305 873 PDIEVLGds----nELYMNEVYN 891 Clostridium phytofermentans ISDg
ZP_01863897  405 SVMPNTCiag-ddiSNQLGDPNE 426 Erythrobacter sp. SD-21
ZP_01626544  400 SSGGFTLcparddlTRNFGDPAE 422 marine gamma proteobacterium HTCC2080
ZP_01905797  381 PDCEAADd-----vFHFLGDPEE 398 Plesiocystis pacifica SIR-1
YP_001610806 376 PDCAADDt-----lGAELGDAGE 393 Sorangium cellulosum 'So ce 56'
YP_002660780 396 DTGRFTLcalednyRGAFGSTDD 418 gamma proteobacterium NOR5-3
ZP_01043012  378 PDCPVNDa-----iVADWGEFAD 395 Idiomarina baltica OS145
ZP_01720231  378 PDFLVGDs-----pQFNWGDPND 395 Algoriphagus sp. PR1
AAP58520     366 PTCAAPDd-----lEHDLGAADE 383 uncultured Acidobacteria bacterium

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap