1FC7


Conserved Protein Domain Family
Peptidase_S41_CPP

?
cd07560: Peptidase_S41_CPP 
Click on image for an interactive view with Cn3D
C-terminal processing peptidase; serine protease family S41
The C-terminal processing peptidase (CPP, EC 3.4.21.102) also known as tail-specific protease (tsp), the photosystem II D1 C-terminal processing protease (D1P), and other related S41 protease family members are present in this CD. CPP is synthesized as a precursor form with a carboxyl-terminal extension. It specifically recognizes a C-terminal tripeptide, Xaa-Yaa-Zaa, in which Xaa is preferably Ala or Leu, Yaa is preferably Ala or Tyr and Zaa is preferably Ala, but then cleaves at a variable distance from the C-terminus. The C-terminal carboxylate group is essential, and proteins where this group is amidated are not substrates. This family of proteases contains the PDZ domain that promotes protein-protein interactions and is important for substrate recognition. The active site consists of a serine/lysine catalytic dyad. The bacterial CCP-1 is believed to be important for the degradation of incorrectly synthesized proteins as well as protection from thermal and osmotic stresses. In E. coli, it is involved in the cleavage of a C-terminal peptide of 11 residues from the precursor form of penicillin-binding protein 3 (PBP3). In the plant chloroplast, the enzyme removes the C-terminal extension of the D1 polypeptide of photosystem II, allowing the light-driven assembly of the tetranuclear manganese cluster, which is responsible for photosynthetic water oxidation.
Statistics
?
PSSM-Id: 143476
View PSSM: cd07560
Aligned: 314 rows
Threshold Bit Score: 135.232
Threshold Setting Gi: 194557269
Created: 24-Aug-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Catalytic dyad
Conserved site includes 2 residues -Click on image for an interactive view with Cn3D
Feature 1:Catalytic dyad [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
1FC7_A         9 FLEAWRAVDRayvdksfngqsWFKLRETYlkkepmdrRAQTYDAIRKLLavldDPFTRFLEPsrlaalrrgtagsvtgvg 88  Scenedesmus obl...
Q7MVK0        42 YVQSMDVLSNi----------IGNVRLYFvdt--isiKHMTRRGIDAMLgg-lDPYTEYIPYeemdelklmttgeyagvg 108 Porphyromonas g...
ZP_02426063   36 LGRNMELLVNm----------MRELSLFYvde--vdpDQLMQDAAEGMTrn-lDPYTEFLPEeqmsnfdllttgkyggig 102 Alistipes putre...
YP_001129549  39 YFSAVKGIELlg-------dvYREVAENYvdt--lsiSRLSYSAIDGMLep-lDPYTVFLDEeqsrelgeltnsqyagig 108 Prosthecochlori...
YP_380282     48 SFAVVSSIELls-------evYRELAAGYvep--ldtALLMKTGIRGMLrs-lDPYTTLLERddadeladitrgryvgig 117 Chlorobium chlo...
YP_001995524  55 FFAVARNIELlg-------rvYREVAENYvdd--invSEFMMAGIDGMLst-lDPYTVFMDEeqaddleqlttgkyagvg 124 Chloroherpeton ...
YP_444915     34 LFELRKGLRIfg-------avYEEVVTGYvep--vdpGHLVRVGVDAMLee-lDPYTTYVDEsenariaiitegqyggvg 103 Salinibacter ru...
XP_002296172 116 TERAATLYKSi----------LGSLDDSYvdq--vdiNQLFELSVRGMLqsldDPYTEYISSrdmlnrrdlvgigafvme 183 Thalassiosira p...
XP_002184343 211 LSQPVTLFETi----------LGDLEQAYvee--vdtNKLFETGIAAMLrs-lDPYTEFEAAqeavaltesiegryggvg 277 Phaeodactylum t...
YP_002760700  50 PLGGARLFDQv----------VATIAQRYvds--ldaTQVYDKAVAGMLrelgDPYTTYLAEdrlrrlneqisgtyagig 117 Gemmatimonas au...
Feature 1                                                                                        
1FC7_A        89 leitydggsgkdvvvltpapggpaekagaragdvivtvdgtavkgls--------------------------------- 135 Scenedesmus obl...
Q7MVK0       109 aiisqrpdsaviiqrpmegmpadeagliagdriltidgkd---------------------------------------- 148 Porphyromonas g...
ZP_02426063  103 smirkkgdyvifaqpyegspadragirigdkilsieged----------------------------------------- 141 Alistipes putre...
YP_001129549 109 itiasiegsifvtsvekgwpaakagmrvgdriteingv------------------------------------------ 146 Prosthecochlori...
YP_380282    118 islatlekklyvtavneespaaaagirtgdailainea------------------------------------------ 155 Chlorobium chlo...
YP_001995524 125 isinvkdnqvivmsvaegysaekagvrigdviisidgqd----------------------------------------- 163 Chloroherpeton ...
YP_444915    104 ldigrrngaltvvapvaggdayqqgvrtgdvitevadqpa---------------------------------------- 143 Salinibacter ru...
XP_002296172 184 gedgfhvilslegyafdaglrvgdrllavdgkpitndq------------------------------------------ 221 Thalassiosira p...
XP_002184343 278 lviagtpraaaepksnanqllpaaaqsdtasqedternrntmsnvmteeeedeymdrkeqrkalekarkqgirvvtafeg 357 Phaeodactylum t...
YP_002760700 118 lqidireswpvvlepinggpseragilagdriiqigke------------------------------------------ 155 Gemmatimonas au...
Feature 1                                                                                        
1FC7_A       136 ----------------lydvsdllqgeadsqvevvlhapgapsntrtlqltrqkvtinpvtfttcsnvaaaalppgaakq 199 Scenedesmus obl...
Q7MVK0       149 ------------------------frksttpkvsqalkgiagtvakvtvmrygetkprtfsvkrqkvimnsvtysgmldg 204 Porphyromonas g...
ZP_02426063  142 ------------------------tkgwdpaqissalkgtpnttvrivierliggehdtltltrervaipsvpyagfvak 197 Alistipes putre...
YP_001129549 147 -------------------------qlkkksldrvrelikgnagvplalavarrnsgrltfrllreeirlstvtfsglvd 201 Prosthecochlori...
YP_380282    156 -------------------------kvaniavdslrtllhgtngspitfqlerrgsaprtttvqrqsvplksvpyyelhn 210 Chlorobium chlo...
YP_001995524 164 ------------------------vrgrsvldirnlikgdintevqisvereglpkpisfqlvrhdvvlknvthvdlgkd 219 Chloroherpeton ...
YP_444915    144 -----------------------aslsvedveallrgqpgttvpvtveragrpspltltltrervelpdvtyqgrvgaer 200 Salinibacter ru...
XP_002296172 222 -------------------------klgdvrdllvgkpgskvlvsfhrpgvdgtqtieierkpvkfpdvrysgmldsegg 276 Thalassiosira p...
XP_002184343 358 yafdyglrvgdkllaiddkpltadttvedvrnmlrgqpgtlvsiefnrdgvddvqtvtmpravvrlrdvklatlvgsprd 437 Phaeodactylum t...
YP_002760700 156 -------------------------strgwtrdevsrvvrgpqgtavsfviergdqhiplsivrdkvhlravqrvallpn 210 Gemmatimonas au...
Feature 1                                                                                        
1FC7_A       200 qLGYVRLATFnsNTTAAAQQAFTELSKqg---------vaGLVLDIRnNGGGLFpAGVNVARMLVd-rGDLVLIadsq-- 267 Scenedesmus obl...
Q7MVK0       205 sIGYIRLNNFtdKSAEEVRTALLDLRDkqg--------akGLILDLRgNGGGLMqAAIEIVNLFVpkgKEVVTTkgria- 275 Porphyromonas g...
ZP_02426063  198 gIGYIQHSDFteGSYEEMRTAIEKLRTqdt--------lrGLILDYRgNGGGILqEAVKIVSMFVpkgTEVVRTkgraa- 268 Alistipes putre...
YP_001129549 202 gFGYIGLESFgtRSFEDVQKALAGIREeaahs---gsppkGIILDLReNPGGLLdAAVDVTSLFVpeeSPVVSIrgrsa- 277 Prosthecochlori...
YP_380282    211 nIGYIALDGFttRSPHEVRSAWQSLQQqatan---kqplrGLIVDLRdNSGGLLdAALEITSLFVpngSEVVSIkgrst- 286 Chlorobium chlo...
YP_001995524 220 gIGYVDIQRFsvKAAEELEDAIFMLQDsakar---ktqmkGLILDLRdNPGGLLdVAVSVAGKFVkkgSTIVTTrgrds- 295 Chloroherpeton ...
YP_444915    201 eLGYVKLERFtrDAPGAVEAALDDLRDtgp--------lqGVVLDLRdNPGGLLrAAVRITALFVpqgTEVVSTrgrdd- 271 Salinibacter ru...
XP_002296172 277 cIGYIQLAQFgmDVGDSMKKSIQSLQEesyrkt-gsldltGIVLDLRnNSGGKLqSAIKVASLFVpkgTYLGSSvgngrl 355 Thalassiosira p...
XP_002184343 438 gIGYIQLSGFtsNAGAEMRQAITYLQQrtldatngdkslqGLVLDLRgNPGGLLtSAVDVASLLVpngSDIVSArgrgf- 516 Phaeodactylum t...
YP_002760700 211 gVGYVDVNVFsaQTADELRAAVDSVVRmg---------arALVMDLRgNPGGLLeQGVAVAELFLdrgQNIVQLrgrpgt 281 Gemmatimonas au...
Feature 1                                                        #                          #    
1FC7_A       268 ----girDIYSadgns----------------idsatPLVVLVNrgTASASEVLAGALKDskRGLIAGE--RTFGKGlIQ 325 Scenedesmus obl...
Q7MVK0       276 ---esasVFRTltepi-----------------dtklPIVVLIDgqSASSSEIVAGALQDmdRAVLMGQ--KSYGKGlVQ 333 Porphyromonas g...
ZP_02426063  269 ---tqenVFRTandpi-----------------lpdlPLAVLINgnSASAAEIVAGSLQDldRAVLIGQ--KSFGKGlVQ 326 Alistipes putre...
YP_001129549 278 ---gstkSYTTkrppe-----------------esdiPLAILINarSASAAEIVSGAVQDldRGILIGE--RSFGKGlVQ 335 Prosthecochlori...
YP_380282    287 ---hshsTLKTttepl-----------------datlPVALLINgdTASAAEIVAGALQDvdRAIILGE--RSYGKGlVQ 344 Chlorobium chlo...
YP_001995524 296 ---vkvrSYVSttppl-----------------lkdlPVVVLINksSASASEIVAGAVQDldRGVIVGT--RSFGKGlVQ 353 Chloroherpeton ...
YP_444915    272 ---deteSYTTdrvpl-----------------lpetPVVVLVNgqSASASEIVAGALQDhdRGVVMGT--TTYGKGlVQ 329 Salinibacter ru...
XP_002296172 356 dklypdeSYYAsvadtsslgnadsfddytqlidtdktHVVILTDhkTASASEFLTGVFQDldLGLVVGIdaTTLGKGiGQ 435 Thalassiosira p...
XP_002184343 517 ---pgmlYRSRvdpil-----------------npntKLAVLVNgqTASAAEIVAGAVQDldVGVIVGAd-RSFGKGlVQ 575 Phaeodactylum t...
YP_002760700 282 -psqsytDSVPqrw--------------------ptlPLAVLLDrsSASASEIVAGALQDhdRAIVLGM--TSFGKGsAQ 338 Gemmatimonas au...
Feature 1                                                                                        
1FC7_A       326 TVVDLSdGSGVAVTvARYQTPaGVDINk-----------------------------------------iGVSPD--VQL 362 Scenedesmus obl...
Q7MVK0       334 TTRQLPyNGVIKLTtAKYYIPsGRCIQrldysrtnrtgmataipd-------slhkifytaagrrvedagGILPD--IEV 404 Porphyromonas g...
ZP_02426063  327 TTRPLGyNTLLKLTtAKYYIPsGRCIQaidyssrkqdgtvgkvad-------slvrefttrggrkvydggGISPD--IAT 397 Alistipes putre...
YP_001129549 336 SVINLPyDSALKLTtAKYYTPsGRLIQkeengalasardvltppkrh----gdghevfrtaakrkvygggGIAPD--ITV 409 Prosthecochlori...
YP_380282    345 SVKKLSyGNTLKFTtAKYYTPsGRLIQkelkkessphstnadskqalasavpdttqrfytrnhrivygggGIMPD--VEI 422 Chlorobium chlo...
YP_001995524 354 TITRLPyNTSLKITtAKYYTPsGRLIQevdyfhrnklegkrdvfrve---pdtihnmfrtkngrpvydggGIAPD--LAV 428 Chloroherpeton ...
YP_444915    330 NVRSLPhNTALKLTtAQYYTPsGRTIQrldanptdttappsr--------------vhettggrtvrdghGIRPD--VRV 393 Salinibacter ru...
XP_002296172 436 RELPVG-DGALKLTyHEFHTPsGRCVQlraknddatyggrak-------------kvlrtangrdivdrnGISVDykITT 501 Thalassiosira p...
XP_002184343 576 NVEELPfNTALKFTvAKYYTPsGRCIQgvnykgggglkeenggyiask-vadadrkvyytkagrmvrdggGVEADykIEA 654 Phaeodactylum t...
YP_002760700 339 NVYPLSsGGALRLTiARWYTPlGRGINrapavdadgepeldtglvtl---pdtvkpryrtdagrtvfgggGITPD--IVV 413 Gemmatimonas au...
Feature 1         
1FC7_A       363 D 363 Scenedesmus obliquus
Q7MVK0       405 K 405 Porphyromonas gingivalis
ZP_02426063  398 E 398 Alistipes putredinis DSM 17216
YP_001129549 410 E 410 Prosthecochloris vibrioformis DSM 265
YP_380282    423 K 423 Chlorobium chlorochromatii CaD3
YP_001995524 429 D 429 Chloroherpeton thalassium ATCC 35110
YP_444915    394 A 394 Salinibacter ruber DSM 13855
XP_002296172 502 P 502 Thalassiosira pseudonana CCMP1335
XP_002184343 655 P 655 Phaeodactylum tricornutum CCAP 1055/1
YP_002760700 414 G 414 Gemmatimonas aurantiaca T-27

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap