Conserved Protein Domain Family
Peptidases_S8_14

?
cd07497: Peptidases_S8_14 
Peptidase S8 family domain, uncharacterized subfamily 14
This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Statistics
?
PSSM-Id: 173821
View PSSM: cd07497
Aligned: 5 rows
Threshold Bit Score: 318.645
Threshold Setting Gi: 118431371
Created: 1-Jun-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
active sitecatalytic triad
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                         
NP_558788     166 GTGVVIAIVDTGVDYGHPDLqdalawliktsdgkeiiaasiattgtslqyktlkgqtatiplsqissveplvldadesqv 245  Pyrobaculum a...
NP_147357     195 GEGVKVAVVDTGVDYGHSDLgvesiaraedgtplifdadqlgfaltlseavkdeegyvnvstpvpfidlffmgygeaeag 274  Aeropyrum per...
YP_001013186  191 GQNTTLAIIDTGVDYASPGLgldaiardeygiplifdadslglvltpvpaipvnethvyvdvselyffyppynvfkdnvs 270  Hyperthermus ...
ABZ08035      149 GRGITIAIVDTGVDFSNPDIresllrdednkpvmldadgqglvitnstfaakisnfgilknytkefpenvtstvyvkndg 228  uncultured ma...
NP_147793     182 GEGVVIGVIDTGVDFSGPGLgedkiafspeglplivdygmvflaaplyvevdpdsgsgavdfqglytveagpagvgllvk 261  Aeropyrum per...
Feature 1                                                                                         
NP_558788     246 lilesftasggyiatsgmtfavidgptlef-------------------------------------------------- 275  Pyrobaculum a...
NP_147357     275 wllyispdgtvayyefpidrffvgdiesaggvfkfglavqtvfi---------------------------lygslgiln 327  Aeropyrum per...
YP_001013186  271 farfgdvwlywnlpeywrvpldvyagfstsgvvprfgiavriistpvgtvafgap------vlvydsdgdgyydtvrvdm 344  Hyperthermus ...
ABZ08035      229 vfldiiqkgngtnisvynglypyvdflpfgtpvfngtlshdmkigksksdyi-----------esksriyhlgviyqphm 297  uncultured ma...
NP_147793     262 rsggfasiaylspeggyssgyveysleppvlpqevvdaalqggappryglavsenmaytldggllwyrmtvpglvadada 341  Aeropyrum per...
Feature 1                                                                                         
NP_558788     276 -----vnatcnykvaglvsksgvykfgmtslfipwyggyvqvgvvmydpdqpglytaarvdinnncdftddpelryygnr 350  Pyrobaculum a...
NP_147357     328 yslpvlladgdgdgsyetvyadlstayylflkalsdtgmisgepdpslldlsfadetpasygsevlardftgdgvndfsa 407  Aeropyrum per...
YP_001013186  345 tttyyyfyqavnqsgalaslylyqppysgpdydfsdepairygneiaaldldgdgvydfsvgtlagyiydafgivlleen 424  Hyperthermus ...
ABZ08035      298 gflqvvpvlvtdpneagvydtitpdmssswmdytkrasgdsttkqnydfdftdedpitigsgnelllydadlpqtehfwe 377  uncultured ma...
NP_147793     342 dglydtiyldastavyhlasaarqagltlypapsaadysfegekpvtpasplagydargdgdidlpvgalagytvdlsga 421  Aeropyrum per...
Feature 1                                                                   #                     
NP_558788     351 livdsqssptvslgvAGGYFYDWGLWFDIYa-----rFYPGWDLagnyl-sifyDFNSHGTACSSVAAGRgkavynlg-- 422  Pyrobaculum a...
NP_147357     408 galagwtydwvglltGESVNLGWRLGFDYAg-----lVLPGLDPqgrwv-silyDTLAHGTSVATVIASRgnvefnlg-- 479  Aeropyrum per...
YP_001013186  425 nvlkqmlaglepgygVSVFNVWDMWSFDYLg-----yVWPGMDVwagryvvleyDFHSHGTFCATTAAGRpawgytgyg- 498  Hyperthermus ...
ABZ08035      378 rqadysagtvgaqivDIYGVFSKKAKIDDKlgavngtLLPAMDKdgrff-gvmnDPFPHGTSSASVIASKgkmeydiyn- 455  uncultured ma...
NP_147793     422 algmatgilgemaagLPEGGATLLPTEDLPag----yLLPGMDFwrgsyavfhtDDDGHGTKAASTAAGRefifraetgl 497  Aeropyrum per...
Feature 1                                                                                         
NP_558788     423 -ylgqqrlrGIAPGAKVLGVKGLWWGMvep-----------------gmMWAAGFDvns----------------egqWY 468  Pyrobaculum a...
NP_147357     480 --yietslrGVAPGAKIAAGGSFLINVfv------------------aqLFLSGFEpqds---------------plnWV 524  Aeropyrum per...
YP_001013186  499 eysgwslivGQAPDTKIAAASALSMGNvfaavyffs-----gfdvvnpyGVENGFFhyyvpvpgsvnpwiafeggilvWN 573  Hyperthermus ...
ABZ08035      456 -ntkkfsikGIAPDVKILPVKALWFGDtiy-----------------awLWTAGFDnve-----------------nsWI 500  uncultured ma...
NP_147793     498 glevrmlvsGTAPEARLAASSFYIYEQamltltghvmvdagtgeplwipPWMGGVDpwdrldprl-----ngggvkaeWA 572  Aeropyrum per...
Feature 1                      #                                                                  
NP_558788     469 WTGQKRVHVISNSWGIStfiydya-afgydfeSAVINALAtpgfldrnyPGIVIVQAGGNGGYGFGTITsPGAAVGAITV 547  Pyrobaculum a...
NP_147357     525 YTGEHQVDVINNSWGNSyialrgf-ltgaddyATIEDYIVs-------aSGTVIVHAMGNGGPGYGTATtPGAGSLIISV 596  Aeropyrum per...
YP_001013186  574 YTGKPRVDATSNSWGASgwalwgw-asgmdpiSVVFDYTSl-------vSKTPHFVAAGNGGPGWGTVTsPGASAMAITV 645  Hyperthermus ...
ABZ08035      501 YTGGPRADIISNSWGISnfpntgy-apgldisSLLLNALVtpgslhenyTGVTIVSSAGNSGHGYGTIGaPGISSFGLSV 579  uncultured ma...
NP_147793     573 WTGTPLVDLTTNSWGISslqyyadkplgleevSLFIDSITl-------eTGVPHFIAAGNGGPGLGTVTaPATARLAVAV 645  Aeropyrum per...
Feature 1                                                                                         
NP_558788     548 GAATSGhfwlalg------ipfngfRWGDIISWSLRGPTPAGYVKPDVVNIGAFGIaaypvgwg--ryyygipeDWDIFG 619  Pyrobaculum a...
NP_147357     597 GASTLFdyrpfy--------gylpsPGGDVISWSDRGPSQIGVAKPDVVNIGSFAWagvpvlt----glgngslAFDIFG 664  Aeropyrum per...
YP_001013186  646 GAATEFtyrpfy--------gylpgGNKEIVSWSNRGPAETGIAKPDIAAIGSFAWamgrpwdalawgaldgffAFDLFG 717  Hyperthermus ...
ABZ08035      580 GAVTNNdfvgyglfkdqprfgnttdHSDHVVDFSSRGPGIIGDPKPDLMSIGAYGFvptlvtks---sadsenePFILFG 656  uncultured ma...
NP_147793     646 AAATDMaylsliqpg-ylpllaglgGYGDPAYFSARGPSHAGAPKPGLAAIGGFAYttgrsldhytggrldpraAPLLFG 724  Aeropyrum per...
Feature 1           #                                          
NP_558788     620 GTSQATPLTAGVVALVLSSIadkadp---asvdpfLVRQFIASTA 661  Pyrobaculum aerophilum str. IM2
NP_147357     665 GTSEATPMTSGSVALVISAYqqafga----kpspgLVKAILKSTA 705  Aeropyrum pernix K1
YP_001013186  718 GTSQATPMTAGVASLVITAYkqatgk---dfmpapLLKTILMNTA 759  Hyperthermus butylicus DSM 5456
ABZ08035      657 GTSMSAPIVAGSAALVAESLnekei-----eydpfKIRNILMSTA 696  uncultured marine crenarchaeote HF4000_ANIW141N1
NP_147793     725 GTSMATPMAAGAAALAIQALkeslgverlgleewlRVYTALSMTA 769  Aeropyrum pernix K1

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap