Conserved Protein Domain Family
Peptidases_S8_5

?
cd07489: Peptidases_S8_5 
Peptidase S8 family domain, uncharacterized subfamily 5
gap in seq This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Statistics
?
PSSM-Id: 173814
View PSSM: cd07489
Aligned: 30 rows
Threshold Bit Score: 282.57
Threshold Setting Gi: 39946194
Created: 2-Mar-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
active sitecatalytic triad
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                              #                                                         #
CAQ76821      168 GVNETHEag-llGAGIKIGVLDTGVDYLNPILGGCFGPGCHMSFGYDLvgddyd------gdnapvPDVDPFAsc--dPH 238  Leucosporidiu...
XP_759171     199 GVDKVHEkg-flGRGQVVGVIDTGVDYRHPALGGKPGNQPCFGPGCLViggygfvddkfngtntpvASSDPYDc---qGH 274  Ustilago mayd...
XP_367433     131 GVKELHDmd-itGSEITVAVVDTGLDYLHPALGGGVGAGFKVRFGIDLvgddfk------vglpprPRSDPYAec--lAH 201  Magnaporthe g...
YP_605685     148 ADIAQNElg-ltGKGVKVGVIDTGIDVDHPAFQGRIVAGYDFVGDDYGkdgk----------yvpvPDDNPDDc---nGH 213  Deinococcus g...
YP_001614329  158 GADVVRRelgvtGEDIRVGVIDSGIDYHHPDLGGCFGPGCRVAFGYDFvgddfvas---datkppvPDGEPDDc---lGH 231  Sorangium cel...
XP_001938160  152 GVDKLRAqn-ltGKGIFIGVIDGGVDFMHPALGGGFGAGFKISAGEDLvgsayd------gkntpvPGGKPMDc---yGH 221  Pyrenophora t...
CAG38357       94 GVDKLHAqg-itGKGIKIGIIDTGIDFTHPDLGGGIGPGFKIIGGFDFvgdafn------gsntpvPDPSPLDqc--nGH 164  Phanerochaete...
XP_001549173  164 GVDKLHAkg-ikGKGIKIGIVDTGVDYRHPALGGGFGTGFKITGGYSFvydn----------gtlgDSSDPLStcltgGH 232  Botryotinia f...
XP_362634     155 QVDRLHDag-itGAGVRLAVVDTGVDYTNAILGGCLGGGCVVTHGWDAvgvdsllg--asgavapvPDDDPMDc---aGH 228  Magnaporthe g...
XP_001830834  145 GVDKLHGeg-itGKGVKVAVIDSGIDYNHPNLGEGFGEGFKVAGGHDFvgdefn------gtnemkPDDDPMDec--nGH 215  Coprinopsis c...
Feature 1                                                        #                  #             
CAQ76821      239 GTHVTGIIGalpna----fgftGVAPAATLGHYRvfg-ctgFVGEDIILAGLMRGVedNCNVLTLSLGGPGGWvkg-tpA 312  Leucosporidiu...
XP_759171     275 GSHVTGTIAanst-----lgftGVAPHAKIRAYRvfg-csgSTPDDIIIAALQRAFfdGCDVLSLSLGGPGGWse--apS 346  Ustilago mayd...
XP_367433     202 GTHVSGIVAgnqss----tgfvGVAPAANLEHYRvvgchkiPIQSDMIIQAVLMAQarEVDVLSLSLTLDSGPypd-daL 276  Magnaporthe g...
YP_605685     214 GTHVAGIVGgndpa----tgfkGVAPEVSFGAYRifg-cegSSYDDVILAAMERAQkdGMQVINMSLGSAFENwke-tpL 287  Deinococcus g...
YP_001614329  232 GTHVAGIIGang-------vvqGVAPDVTFGAYRvfg-crgGSRADIILKAMERAAsdGMHVINISIGTPFQWpd--ypT 301  Sorangium cel...
XP_001938160  222 GTHVSGIIGadpnp----ygftGVAPEATLGVWKifgcvspSTSSDMIMRGFNIAYeaGVDIISASFGTSSGWse--deV 295  Pyrenophora t...
CAG38357      165 GTHVAGIIGanpgn---afnisGVAFDASITSYRifg-csgSTTDDVIVDALLRGVseGQDILTMSLGGPDGWte--ntA 238  Phanerochaete...
XP_001549173  233 GTHVSGILGmdpisengyfpisGVAPEANLYMYRtfd-csnAGGSDTIMAGMLKAHedGVDVISMSLAVGTEFpstpdpL 311  Botryotinia f...
XP_362634     229 GTHVAGIVAalpse----fgflGAAPGVSLGAYRvmd-cagFGTEETIAAGMLRAFddGNHILTLSVSVPGGLpd--sfV 301  Magnaporthe g...
XP_001830834  216 GSHVAGIIAasgen---nwnvtGVAPDATLYAYRvfg-clgFVTDTLIIQAMLRAVkdGVDVINISIGGRDGWtr--atG 289  Coprinopsis c...
Feature 1                              #                                                          
CAQ76821      313 SILIDQIEAq-GILVTVATGNSGAEGmff-----sesPASTINGLSIASTDvtdliaynatvsgqpaipylsatplnvva 386  Leucosporidiu...
XP_759171     347 SAVAGRIASl-GTPLAIANGNDGAFGmay-----assPGTGSNVMAVGSVQnkdltgisanvvpstlsqknvtllqgspf 420  Ustilago mayd...
XP_367433     277 SEVLTRISRagQILVVVASGNYGWRGpfs-----araPASAREVLTVGSVNsvysvrsrprasftmrnqttdfawapatp 351  Magnaporthe g...
YP_605685     288 AKAADRLVKk-GVVVVASGGNSGANGqys-----mggPTMGDNVISVASVDnvkvdldsftlsdgskvgyyvatgapept 361  Deinococcus g...
YP_001614329  302 ATAASALVGr-GVAVVASIGNSGEKGlwa-----agaPGVGEAVIGTASVDstrvttlsftvapgnavigytrgagsppa 375  Sorangium cel...
XP_001938160  296 SVVVQRISEk-GVVVVVAAGNNGTIGlfd-----aqaPANSAGALAVASIDnyvqplvwsnatyttnganstnfgyiksy 369  Pyrenophora t...
CAG38357      239 SVVSSRISDm-GKIVTIAAGNDGADGmff-----tsgPGNAIDAISVASLDntviplqnatvhgvqhdpityfdalplpi 312  Phanerochaete...
XP_001549173  312 ASVVQSITQa-GTAVIVAVGNEGSLGqyatelftadyPSSEPGAIAVGAIAnrdfplvypavdsanstlgyasvwpvnlt 390  Botryotinia f...
XP_362634     302 SMTAARIVEa-GVPVFVAIANTGETGslfd----pvaPADARHVGSVSSFDpvqepavyavaeyviddgeveefewvpll 376  Magnaporthe g...
XP_001830834  290 SVVASRIAAt-GKVVVISAGNEGMSGafy-----tsgPANGIDVISVGSVEntilplqtvnvvgaehdpipyfswlpfnv 363  Coprinopsis c...
Feature 1                                                                                         
CAQ76821      387 nsfrvhftstdpnnpvdacsplpagapdfanyvtvvqrgtctfvtkyqn-----------------vlnaggkivllyns 449  Leucosporidiu...
XP_759171     421 tfadgqskvlevyatsssltvtddacsplpdstpdlsnkvvligrgtclf---------------atkfanaaakgakyv 485  Ustilago mayd...
XP_367433     352 grfpsspvplqaatvdmsinndacsgfgddvhfpstsvilvgrggcpfdvkm----------knlvargakfvlvyddkd 421  Magnaporthe g...
YP_605685     362 kgltlpitkkpgsttttpndgctasggfaagsltgkavlirrggctfy-------------------ekasnaqkagaaa 422  Deinococcus g...
YP_001614329  376 plsgsaalartgtttsardacaelpagslarqialvrrggcsfhqk----------------------aahaqaagavav 433  Sorangium cel...
XP_001938160  370 pqnisfehatfplyaldynrnvsdtactpladstpdlggyitlvqastfidr----------ctlddqlinlgakgakrv 439  Pyrenophora t...
CAG38357      313 tdtlpifatstnttidddacdplpdstpdlskfivivrrgtctfvq-----------------------kltniaakggn 369  Phanerochaete...
XP_001549173  391 vpvyiylvsdgcdsstwadalntvsqsgllnttifafeafetttycnpnsiasg------wksgkvqpvyvmgynsdian 464  Botryotinia f...
XP_362634     377 ngrydmqggadqqafrlidlnsfvvngtvmggcqvipdsvpdlsgylvlvertpanlclfrtqrenikakgadhimfwas 456  Magnaporthe g...
XP_001830834  364 tedlplyatsndttveddaceelpedtplldkylvlvrrgscpftq-----------------------kienlrkknat 420  Coprinopsis c...
Feature 1                                                                                         
CAQ76821      450 egagnlpyltpngvgidavaglrrsdglkllsyyqnankrltlrfpkgkivagltdtitggliSGYSTFGPTnd-lyGQP 528  Leucosporidiu...
XP_759171     486 lvynslasityvttdvagqqaasltrddglfikqqinngvkvsldfsntrlatvpdtstgglmSSFSTYGPSyenklNVP 565  Ustilago mayd...
XP_367433     422 gplfqfdnifdgitaagsitaqvgrdlinalatgsdvflnmdpdfhnmpyirvegnpqppgqvNGQGSWGPTgl-gyDLT 500  Magnaporthe g...
YP_605685     423 vilynnaagyisptvsgeppitipvvaisdtdgakinsllgsgvsvtfdggkiavanptgntiSSFSSIGMSae-leLKP 501  Deinococcus g...
YP_001614329  434 lfyndrsgamspsvegdppitipvvgiaqadgeqlnarldagpvthswthravaarnstaglvSRFSSHGLSaa-lsFKP 512  Sorangium cel...
XP_001938160  440 ffhirnsytyfpvvnstkvacgmvseregqhfldllqagkqvnvtftgagyinstvatnktqiSDFSSWGPTne-lsIKP 518  Pyrenophora t...
CAG38357      370 vsliydngngfadidvgnftsaliqaadgeflvqqfasganvslsfpqtgastqfpdptggliSSFTSYGPTnd-mfFKP 448  Phanerochaete...
XP_001549173  465 sylleynvfspsyfgsvsyinlntddgitlvnnyglvggfpkytltftgnnfksppqhtgglvDYYSNFGPTyftydLKP 544  Botryotinia f...
XP_362634     457 edvirgivnddlqtfmatttpapatewrkalaagsnvtvtlttptkskpkvvwsannktggyvSSFSSWGPTld-lrPAP 535  Magnaporthe g...
XP_001830834  421 qalfydngsnflgivvgnftgalikaedgewlveqflsgadvklnfpqtggeidhpavggglmSNFSSYGPTnd-fyFKP 499  Coprinopsis c...
Feature 1                                     #                                                   
CAQ76821      529 TLSAPGGNILSTFPLseg--gvAVISGTSMSCPFVAGSAAVLMAAra--sENLTPLEIRSLLTTTAKLTPVSllgstpl- 603  Leucosporidiu...
XP_759171     566 VVSAVGGNVLSTYPLakg--ayAILSGTSMATPFMSGSIAVFQSAr----GKTSPEDLNSIFANTATPIKNAtgdatly- 638  Ustilago mayd...
XP_367433     501 SILAPGQSIWSTIPRswg--gyGTLSGTSMAAPYIAGCAALVMQVh----PGLVSAEVMGLLSSTARPLSFNdgtnktyd 574  Magnaporthe g...
YP_605685     502 DIAAPGGNIYSSYPLsadpsgyAVLSGTSMASPHVAGAAALMLQAy----PNTQAKDMRTLLMNTASLRWFYnnkplegi 577  Deinococcus g...
YP_001614329  513 DLAAPGGTIYSTVPIeqg--syDTLSGTSMAAPHVAGAVALLLAAr----PELSAARVRDVLQNTAVPAPWSgdlgagv- 585  Sorangium cel...
XP_001938160  519 EVAAPGGNILSTWPLikg--gyATMSGTSMAAPYMAGTIALLMQAkg--kKFATQSEIFNLLTTTADPLKWIarnstfl- 593  Pyrenophora t...
CAG38357      449 AVSAPGGNILSTFPVplg--sfAVLSGTSMATPFMAGVSALLFGLkgntpEVGRSARDLFETTAQLVPSSHTdgdplq-- 524  Phanerochaete...
XP_001549173  545 QISAPGGHILSTYPLgvn-snyAILSGTSMATPYVAGCFALVKSQf----PTASTSQILDLLQTTAAPVNWVwnstii-- 617  Botryotinia f...
XP_362634     536 VFGGPGRSILSTYLHngg-qgvATLGGTSMAAPFVAASAALLLQAf---nHTLDPQTLQTLLASTAIHSIGNphp----- 606  Magnaporthe g...
XP_001830834  500 ALAAPGGNILSTVPLnms--afAVVSGTSMSAPFVAGSAALILSVrg--vTPEVGRATRNLLETTASYVPSSdaedall- 574  Coprinopsis c...
Feature 1                                           
CAQ76821      604 --vsvirqGGGLVQVAKAlaakTLISPHELLLND 635  Leucosporidium antarcticum
XP_759171     639 --esvahqGTGLVDVNKAlyqqIVLSPTAIELND 670  Ustilago maydis 521
XP_367433     575 flapvamqGNGVVDAMGAakaeTFISDPHLSFND 608  Magnaporthe grisea 70-15
YP_605685     578 -pdyvqrqGAGMVDIVNAydntVRATPSKLSLGE 610  Deinococcus geothermalis DSM 11300
YP_001614329  586 -pesahrqGAGVIRVDRAiratTLISPGKLSLGE 618  Sorangium cellulosum 'So ce 56'
XP_001938160  594 --apvmqqGGGGLNAYKAafttTTVDARFIGLND 625  Pyrenophora tritici-repentis Pt-1C-BFP
CAG38357      525 ---tvaqqGAGLVNAFQAlttdIIITPGELLTND 555  Phanerochaete chrysosporium
XP_001549173  618 --sataqqGAGLINAYDAiyaqTTISPGQIVLGD 649  Botryotinia fuckeliana B05.10
XP_362634     607 -----lqaGAGLVQLWDAahtkGVLSAPSIAFND 635  Magnaporthe grisea 70-15
XP_001830834  575 --qtaiqqGAGLVNVHKAvhttTLVSPGELVLND 606  Coprinopsis cinerea okayama7#130

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap