Conserved Protein Domain Family
Peptidases_S8_Subtilisin_Novo-like

?
cd07483: Peptidases_S8_Subtilisin_Novo-like 
Peptidase S8 family domain in Subtilisin_Novo-like proteins
Subtilisins are a group of alkaline proteinases originating from different strains of Bacillus subtilis. Novo is one of the strains that produced enzymes belonging to this group. The enzymes obtained from the Novo and BPN' strains are identical. The Carlsburg and Novo subtilisins are thought to have arisen from a common ancestral protein. They have similar peptidase and esterase activities, pH profiles, catalyze transesterification reactions, and are both inhibited by diispropyl fluorophosphate, though they differ in 85 positions in the amino acid sequence. Members of the peptidases S8 and S35 clan include endopeptidases, exopeptidases and also a tripeptidyl-peptidase. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The S53 family contains a catalytic triad Glu/Asp/Ser with an additional acidic residue Asp in the oxyanion hole, similar to that of subtilisin.. The stability of these enzymes may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Statistics
?
PSSM-Id: 173809
View PSSM: cd07483
Aligned: 10 rows
Threshold Bit Score: 363.607
Threshold Setting Gi: 86142982
Created: 11-Dec-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
active sitecatalytic triad
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
ZP_00988689  105 QPVIVAVLDSGVDVEHEDLKNKLWTNENEIPGNGIDDDGNGYIDDVHGWNFLGnslginvdqdtlevtreykkylelken 184 Vibrio splendid...
ZP_01061404   78 ENITVAVLDMPVDSDRLSQELSLWINTDEIPDNQKDDDLNGYIDDVNGWNFLGevsgnqqifgkydytrildkylsplpi 157 Leeuwenhoekiell...
ZP_01688989   87 KTVIVAVIDSGIDTKHPDLKGKIWVNKKEIAGNGKDDDNNGYVDDINGWDFIGgkdgkdvdadtyevtrelvrlekkfan 166 Microscilla mar...
XP_001617938  44 REIIVATLDTQIDLDHEDLQGQFWVNKKEIPNNGIDDDNNGYIDDVNGWNFIGtksgnytvwgnfeyvrfvrkwesafeg 123 starlet sea ane...
ZP_02161897   78 MEIIVAIIDLEVNINHRDLKNKIWINTDEIPNNNIDDDKNGYVDDINGWNFLGtkkndptihhkstavrilkkykhfknl 157 Kordia algicida...
ZP_02162129   40 KKVIIAVLDSDVDINHKDLKPFLWKNKKETPNNGIDDDKNGYVDDIYGWNFLGkedseksleytrmeetrilskyskekl 119 Kordia algicida...
ABS01329      81 KTVIVAVIDSGIDIEHEDLVDVIWVNKGEIAGNGIDDDNNGYIDDIHGWNYLGdaydeqleyvrilamgdtnhpdfakaq 160 Polaribacter sp...
YP_444708     93 DTVQVAVIDSGLDIDHEDLAAKLWTNADEIPGNDVDDDGNGYVDDVHGWNFIGgpggknvdqdtyeltriyvdlqerfag 172 Salinibacter ru...
YP_001297252  80 TPVIVGIVDSGVDIDHEDLKGKIWTNPKEIAGNKKDDDNNGFIDDVHGWNFLGdtnneqlemtrivkkgndgsqqfkdas 159 Flavobacterium ...
ZP_01883529   57 KSVIVGVLDGGVDINHEDLKAILWINKKEKAGNGKDDDKNGYIDDVNGWNFLGsakgsinnetleltrlvrrdnarfana 136 Pedobacter sp. ...
Feature 1                                                                                        
ZP_00988689  185 ghwiprkkrkyyqgvesdylsslkddqdalnrvtsatdqane--------------------ykaeileltdhkdftvng 244 Vibrio splendid...
ZP_01061404  158 yklqsldsinsysdnkdlvraskryiekinyaneevayaemieri--------------lydsriilkdylsknyslnel 223 Leeuwenhoekiell...
ZP_01688989  167 vdaeklddkqkeeykyflkvkkayqkqymearqgysilrki---------------------wegyqllqkemgkkdftk 225 Microscilla mar...
XP_001617938 124 kkkedienqnlynyntynwaaamldytkkyynnrtksldysisvyakakdtlkyyfpkedynyekldslyneikgndnrt 203 starlet sea ane...
ZP_02161897  158 desnieskdlkvyrlykraekyqkekieeaklnleyfqgfker-----------------ylklkdtmnvlfnkkdftle 220 Kordia algicida...
ZP_02162129  120 nrlfyrkkvpynyhmvkssydtilkdlkedlelyknihsgy---------------------sqvvdtlksiskykyitl 178 Kordia algicida...
ABS01329     161 aeydkeynetvqrkaqydqiyaqvkeadslvskyl----------------------------------gtedytvaqve 206 Polaribacter sp...
YP_444708    173 vdsarvgpdardryqryqdikrtfqkkrrearkrlakvgkaqk-----------------avqasvdvlkshlgtdsltq 235 Salinibacter ru...
YP_001297252 160 aelekskkelapqkqqidmllgadkavreylk---------------------------------------kpnftladv 200 Flavobacterium ...
ZP_01883529  137 testvkpeeltdfkayqsnkeelqkeldeakqglanfegikla------------------idavvkkmgkenptaqdfk 198 Pedobacter sp. ...
Feature 1                                                                   #                    
ZP_00988689  245 lqpllnnenpsivtaaegllsvfdswysfeylesrrsryqdsldfhlnleLDTRGDIVWDDISNPWEk----GYGNNDVk 320 Vibrio splendid...
ZP_01061404  224 dslkpifkedtlmsnsilrlynfkkygftesyirdyyfkakgrlnfllnpQYEDRILLADDRLNTTTakptfTQGNAKLn 303 Leeuwenhoekiell...
ZP_01688989  226 kdlkefksekeeinrakqmlnfatangiplnqleavfkqyesmykygvnkEFDPRSIVGDDYSKLNEk----GYGNNEVq 301 Microscilla mar...
XP_001617938 204 ykqmlasrdadflalvysfysnyannttsltsllddriqmdsllhknlnvAYNERDYIGDNPEVLEK-----GYGNNKIn 278 starlet sea ane...
ZP_02161897  221 eldslykkntdtiikqklastrylikngidekrinqilnihknniektynIEHFDRLTNDDLNDINDs----IYGNNNVf 296 Kordia algicida...
ZP_02162129  179 dnidniksddvyinqciayakdllqqgytyeliksildykvngikvcmnlQYDNRVLVGDKPYDFCDa----NYGNSLNg 254 Kordia algicida...
ABS01329     207 aitsedealtkatgvlnfmygngfdntqvaltsineglnyfsdklnanlnLEFNGRTTGDNPDDLTDv----GYGNGNVl 282 Polaribacter sp...
YP_444708    236 savrsvtssrrdvrraqqtlqyfydqdlspsdlkdyknqlerqveynynpDFNPRPIVGDDYADKTEr----RYGNNDAe 311 Salinibacter ru...
YP_001297252 201 kamqttdptmvqykgmftqilsgttkaefdsqiqeyqdyvydqlnynlntEFDGRKVVGDNPYDMTNk----HYGNNIVy 276 Flavobacterium ...
ZP_01883529  199 nltpaddmernvqrimvaqlsnatfeefynaqilpgyehfksqldynlnvDYDPRSIVGDDPNNSKEr----FYGNNDVa 274 Pedobacter sp. ...
Feature 1                   #   #                                                         ###    
ZP_00988689  321 gp------vgSHGTHVAGIIAAERNNsvg-idgVADHAQIMAVRMVPNGDERDKDIANAVRYAVDNGAKIINMSFGKSYS 393 Vibrio splendid...
ZP_01061404  304 nai----hylDHGALMTNFISDRKIN-------NDITLKIMPLVVSSLGDEYDKDIYNAIKYAVDNGARVINMSFSKNFS 372 Leeuwenhoekiell...
ZP_01688989  302 gp------daDHGTHVAGIIGANRKNkig-mkgVAENVKIMVLRAVPNGDERDKDIANAIRYAVDNGARVVNMSFGKAYS 374 Microscilla mar...
XP_001617938 279 akiegirsinTHNTEVSSVIASLRFNgig-tdgFSNNIKIMPLTISPLGDEHDKDIAMAIYYAVDNGAKVINMSFGKEFS 357 starlet sea ane...
ZP_02161897  297 gn-----akmDHGTKVAGIIAANRDNedg-iigIVDNIKIMPIIISSYGNENDKDIALAIRYAVNNGAKIINMSIGKEFS 370 Kordia algicida...
ZP_02162129  255 kma----skiDHGTKVSGVIASVLHAl-----dYKKSIEIMPLCITGIGDFLDKDLALAIRYAVDNGARIITLSQTKTFS 325 Kordia algicida...
ABS01329     283 pse----kgeSHGTHVAGIIAASRGNglg-vdgVANNVLIMSLRTVPNGDERDKDIALAIRYAVDNGAKVINGSFGKYYS 357 Polaribacter sp...
YP_444708    312 gp------dpGHGTHVAGIIGATRDNsig-idgVARGVRLMSVRAVPNGDERDKDVANAIRYAVDNGADVINMSFGKSYS 384 Salinibacter ru...
YP_001297252 277 gpk---kegaKHGTHVAGIIAQVRNNnkggdgiASEVVRIMSVRAVPNGDEYDKDIALAIRYAVDNGAKIINGSFGKSYS 353 Flavobacterium ...
ZP_01883529  275 gp------daMHGSHVAGIIAAVRTNdlg-imgVADNVAIMGVRCTPNGDERDKDVANSIRYAVDNGAKVLNMSFGKGFS 347 Pedobacter sp. ...
Feature 1                              # ##                                                      
ZP_00988689  394 PRKYIVDHAFRYAARKGVLIVHSAGNSRNDNDikpsfpnrya-khyrskpisTWLDVGASAKyadetlvasFSNFGQKSV 472 Vibrio splendid...
ZP_01061404  373 TNPEIIKTIIEYANDHNVLIVTSAGNDGVDIDieenkiyp----ndesypvnNFIVVGSTAVqinnnlvskFSNYGKMNV 448 Leeuwenhoekiell...
ZP_01688989  375 PHKAYVDAAVKYAEEKGVLLVHAAGNDHANLDetpnfpnkm--fkesgksatNWIEVGASSWgdeknfvgnFSNYGKTTV 452 Microscilla mar...
XP_001617938 358 LNREWVLEAMQYAERHNVLLVHCSGNDANNIDnypdypndig-ygkslelvnNFINVGSISKrtdstmvtpFSNYGKNNV 436 starlet sea ane...
ZP_02161897  371 INEKWISDAIKYAEKKDVLIVSAAGNEGLNLDdkknyyypndmdenkneilnNFIAVGSSNYsnel--isnYTNYGKKTV 448 Kordia algicida...
ZP_02162129  326 LNDKKVKKAMKYAQKKGVLIIKSAGNENLNLDntlrfpndv--skrgnevlkNLLIVGASGKtlet-ikdeDSNYGMKNV 402 Kordia algicida...
ABS01329     358 KHSDWVRDAIAYASENNVIFVNAAGNEGLDLDliacypndq--vdngpevseTFITVGALEPkygsnmvaaFSNYGKINV 435 Polaribacter sp...
YP_444708    385 PHKGVVDAAVQYADSMGVLMVHAAGNDGASVDstdnfpspy---yadggraqRWIEVGASSWkggeklaasFSNYGAERV 461 Salinibacter ru...
YP_001297252 354 PNKEWVYDAIKYAESKDVLFVHAAGNSSEDIDtapnfpndt--dganpeyadNVLTIGALNYeygasqmanFSNYGKINV 431 Flavobacterium ...
ZP_01883529  348 WDKAIVDEAVKYAVSKDVLLIHAAGNDNKDLEvepnfpeak---yldgqlasSWITVGASGWkkdnslkadFSNYGKTTV 424 Pedobacter sp. ...
Feature 1                                #                                  
ZP_00988689  473 DVFAPGYRILSTtPGNTYGSKSGTSMAAPVVSGVAALVWSRYPDLSVKELKAMLMGESK 531 Vibrio splendidus 12B01
ZP_01061404  449 DLFAPGERILITnSNRDYEIQSGTSVSTALVSKTIGLILSYFPDLTAKEVKEILLSSVT 507 Leeuwenhoekiella blandensis MED217
ZP_01688989  453 DVFAPGVAIYSTtPDNKYADHDGTSMAAPVVSGVAALLMSYFPKLSATDVKEIILKSSV 511 Microscilla marina ATCC 23134
XP_001617938 437 DLFAPGEEIYVAiPDNQYTYDSGTSLAAPMVSGTAALIWLYYPNLTVQEVKNIILESGV 495 starlet sea anemone
ZP_02161897  449 DIFAPGEDIKVL-TWNGVDTDSGSSLSCAIVSGVVALIRSYFPNLNVIEVKNIILKSGI 506 Kordia algicida OT-1
ZP_02162129  403 DIFAPGIEINTLkPDNEYTEGSGSSYSAPIVSIIIGLIYSKYPNLTASEVKQIIMESGV 461 Kordia algicida OT-1
ABS01329     436 DVFAPGAKIYSTtPENEYDTKGGTSMAAPAVAGVAALIWSYYPDLTAKQVKQIIMDSGL 494 Polaribacter sp. 3-17
YP_444708    462 DVFAPGHSIYSTvPDDAYERNDGTSMAAPMVSGLAALIMAYYPSLTATDVRTIILETAT 520 Salinibacter ruber DSM 13855
YP_001297252 432 DIFAPGVNIYATtPKNTYSFLDGTSMASPNVAGVAALVRAYYPSLTASQVKHIIMDSGT 490 Flavobacterium psychrophilum JIP02/86
ZP_01883529  425 DVFAPGVNINSTiPGSQYRKLNGTSMAAPVVAGLAALIRSYYPKLTAVEVKDIIMKSVV 483 Pedobacter sp. BAL39

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap