Conserved Protein Domain Family
Peptidases_S8_SKI-1_like

?
cd07479: Peptidases_S8_SKI-1_like 
Peptidase S8 family domain in SKI-1-like proteins
SKI-1 (type I membrane-bound subtilisin-kexin-isoenzyme) proteins are secretory Ca2+-dependent serine proteinases cleave at nonbasic residues: Thr, Leu, and Lys. SKI-1s play a critical role in the regulation of the synthesis and metabolism of cholesterol and fatty acid metabolism. Members of the peptidases S8 and S35 clan include endopeptidases, exopeptidases and also a tripeptidyl-peptidase. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The S53 family contains a catalytic triad Glu/Asp/Ser. The stability of these enzymes may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Statistics
?
PSSM-Id: 173805
View PSSM: cd07479
Aligned: 11 rows
Threshold Bit Score: 512.384
Threshold Setting Gi: 145355086
Created: 8-Oct-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
active sitecatalytic triad
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                        #                                    #                           
NP_954683     218 WQMGHTGSGVKVAVFDTGLSEKHPHFKNVKERTNWTNek------tlDDGLGHGTFVAGVIASmre-cqGFAPDSELHIF 290  zebrafish
NP_197467     197 WKKGYTGAKVKMAIFDTGIRADHPHFRKIKERTNWTNed------tlNDNLGHGTFVAGVIAGrnpeclGFASDTEIYAF 270  thale cress
XP_002122807  225 WEAGFKGQGVKVAIFDTGLPAKHPHFKNVIERSDWTDee------tsDDGLGHGTFVAGMIGGsssdcpGLAPESELYIF 298  Ciona intesti...
AAH79695      203 WQLGYTGSNVKVAVFDTGLSEKHPHFKNVKERTNWTNek------tlDDGLGHGTFVAGVIASmre-cqGFAPDSELHIY 275  African clawe...
NP_649337     154 WKLGITGKGVKVAIFDTGLTKNHPHFRNVKERTNWTNek------slDDRVSHGTFVAGVIASsre-clGFAPDADLYIF 226  fruit fly
Q14703        203 WQMGYTGANVRVAVFDTGLSEKHPHFKNVKERTNWTNer------tlDDGLGHGTFVAGVIASmre-cqGFAPDAELHIF 275  human
XP_001893210  134 WDMGYKGQGVKVAVFDTGLGKHHPHFRQIVERTDWTNek------taDDGLGHGTFVAGLIASsdhrcvGFAPAASIYAY 207  agent of lymp...
XP_001762565  269 WAKGFTGANVKMAVFDTGVRADHPHFRNIKERTNWTNed------tlNDNLGHGTFVAGVISSqdpqclGFAPDAEIYAF 342  Physcomitrell...
EAL66058      306 WNQGFTGRGTKVAVFDTGLAKDHPHFSNVVEITDWARekvenkkksnTDTIGHGTFVTGIIASssekcmGFAPDAEIYIY 385  Dictyostelium...
XP_002164301  172 WGLGHRGKGVKVAVFDTGLPKSHPHFKNIKDRTDWTEek------tvNDEVGHGTFVAGVIASdre-cyGFAPEADLYIF 244  green hydra
XP_001421802   20 WEQGYTGAGVKMAVFDTGIAEDHPHFRHIVERTNWTNen------qlHDGLGHGSFVAGVVAGtskqcaGFAPDALIHTF 93   Ostreococcus ...
Feature 1                      #                  #                             #                 
NP_954683     291 RVFTNNQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKVWELTAKKVIMVSAIGNDGPLYGTLNNPADQMDV 370  zebrafish
NP_197467     271 RVFTDAQVSYTSWFLDAFNYAIATDMDVLNLSIGGPDYLDLPFVEKVWEITASNIIMVSAIGNDGPLYGTLNNPADQSDV 350  thale cress
XP_002122807  299 RVFTNNQVSYTSWFLDAFNYAILRKINVLNLSIGGPDFMDKPFVEKVWELTANHVIMVSAIGNDGPLYGTLNNPADQMDV 378  Ciona intesti...
AAH79695      276 RVFTNNQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDV 355  African clawe...
NP_649337     227 KVFTNSQVSYTSWFLDAFNYAIYRKINILNLSIGGPDFMDSPFVEKVLELSANNVIMISAAGNDGPLYGTLNNPGDQSDV 306  fruit fly
Q14703        276 RVFTNNQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDV 355  human
XP_001893210  208 KVFTKKQVSFTSWFLDAFNHAILRGINVLNLSIGGPDFTDVPFMDKVWELTANGIILISAIGNDGPKFGTLNNPADQMDV 287  agent of lymp...
XP_001762565  343 RVFTDAQVSYTSWFLDAFNYAIATKMNVLNLSIGGPDYLDLPFVEKVWEMTANNIIMVSAIGNDGPLYGTLNNPADQSDV 422  Physcomitrell...
EAL66058      386 RVFNSEKVSFTSWFIDAFNHVILTKVDVLNLSIGGPDFMDKPFVEKVWEVSANKIIVVSAIGNDGPLYGTLNNPADQSDV 465  Dictyostelium...
XP_002164301  245 RVFTNKQVSYTSWFLDAFNYAILKNIDILNLSIGGPDFMDKPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDV 324  green hydra
XP_001421802   94 RVFTNDQNSYTSWFLDGFNYAIATGVHVLNLSIGGPDYLDRPFTDKINEITAAGIIMISAIGNDGPLYGTLNNPADNLDI 173  Ostreococcus ...
Feature 1                                                                                         
NP_954683     371 IGVGGIDFEDNIARFSSRGMTTWELPGG---------------------------------------------------Y 399  zebrafish
NP_197467     351 IGVGGIDNDDHIASFSSRGMSTWELPHG---------------------------------------------------Y 379  thale cress
XP_002122807  379 IGVGGVDYSNNIARFSSRGMTTWELPAG---------------------------------------------------Y 407  Ciona intesti...
AAH79695      356 IGVGGIDFEDNIARFSSRGMTTWELPGG---------------------------------------------------Y 384  African clawe...
NP_649337     307 VGVGGIQFDDKIAKFSSRGMTTWELPLG---------------------------------------------------Y 335  fruit fly
Q14703        356 IGVGGIDFEDNIARFSSRGMTTWELPGG---------------------------------------------------Y 384  human
XP_001893210  288 IGVGGINVDSKIARFSSRGMTTWELPGG---------------------------------------------------Y 316  agent of lymp...
XP_001762565  423 IGVGGIDYSDHIASFSSRGMSTWEIPHGlvlsmsddtiiflldiihvgclrerekyfstvnieadecsvksvkifegcrY 502  Physcomitrell...
EAL66058      466 IGVGGIDYNDQLASFSSRGMTTWELPHG---------------------------------------------------Y 494  Dictyostelium...
XP_002164301  325 IGVGGINFDDKIASFSSRGMTTHELPYG---------------------------------------------------Y 353  green hydra
XP_001421802  174 IGVGGITDADAIAHFSSRGMTTMELPSG---------------------------------------------------Y 202  Ostreococcus ...
Feature 1                                         #                                            
NP_954683     400 GRVKPDIVTYGSGVRGsgl---keGCRSLSGTSVASPVVAGAVTLLastvl---nrelVNPASMKQALIASARRLPG 470  zebrafish
NP_197467     380 GRVKPDVVAYGRDIMGski---stGCKSLSGTSVASPVVAGIVCLLvsvipearrkdlLNPASMKQALVEGAAKLSG 453  thale cress
XP_002122807  408 GRIKPDIVTYGLNVYAsdl---tgGCRALSGTSVASPVVTGAVALLlssvkk-nqrdlINPGSIKQCLLASADRLPS 480  Ciona intestinalis
AAH79695      385 GRMKPDIVTYGSGVRGsgl---kgGCRSLSGTSVASPVVAGAVTLLvstvq---krelVNPASMKQALIASARRLPG 455  African clawed frog
NP_649337     336 GRMGLDIVTYGSQVEGsdv---rkGCRRLSGTSVSSPVVAGAAALLisgaf--qkidyINPASLKQVLIEGAEKLPH 407  fruit fly
Q14703        385 GRMKPDIVTYGAGVRGsgv---kgGCRALSGTSVASPVVAGAVTLLvstvq---krelVNPASMKQALIASARRLPG 455  human
XP_001893210  317 GRVKPDIVTYGSSVYGsal---dgNCRALSGTSVASPVVAGAVAVMlsgie---dkrlWNPAVVKQALVEGATRLPN 387  agent of lymphat...
XP_001762565  503 GRIKPDIVAYGREVIGski---stGCKSLSGTSVASPVVAGAVCLLasvvpeqyrwnlLNPASMKQALVEGASRLSG 576  Physcomitrella p...
EAL66058      495 GRVKPDIVAYGSGVYGsplnghddNCKALSGTSVSSPVVSGAIALListvk---dksiINPSSMKQVLIESAEKIKN 568  Dictyostelium di...
XP_002164301  354 GRIKPDIVTYGASVTGssl---kgGCRSLSGTSVASPVVAGALALLlssva--sknvvTNPASVKQAIIESATRIPD 425  green hydra
XP_001421802  203 GRVKPDIVTYGDGIWGskv---gdGCRALSGTSVASPVAAGAAVLLssiipeserwsvLNPAVMKQALVEGATRIPL 276  Ostreococcus luc...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap