1CSE,1DUI,1BH6,1SUE,1GNS,2E1P,1V6C


Conserved Protein Domain Family
Peptidases_S8_Subtilisin_subset

?
cd07477: Peptidases_S8_Subtilisin_subset 
Click on image for an interactive view with Cn3D
Peptidase S8 family domain in Subtilisin proteins
This group is composed of many different subtilisins: Pro-TK-subtilisin, subtilisin Carlsberg, serine protease Pb92 subtilisin, and BPN subtilisins just to name a few. Pro-TK-subtilisin is a serine protease from the hyperthermophilic archaeon Thermococcus kodakaraensis and consists of a signal peptide, a propeptide, and a mature domain. TK-subtilisin is matured from pro-TK-subtilisin upon autoprocessing and degradation of the propeptide. Unlike other subtilisins though, the folding of the unprocessed form of pro-TK-subtilisin is induced by Ca2+ binding which is almost completed prior to autoprocessing. Ca2+ is required for activity unlike the bacterial subtilisins. The propeptide is not required for folding of the mature domain unlike the bacterial subtilases because of the stability produced from Ca2+ binding. Subtilisin Carlsberg is extremely similar in structure to subtilisin BPN'/Novo thought it has a 30% difference in amino acid sequence. The substrate binding regions are also similar and 2 possible Ca2+ binding sites have been identified recently. Subtilisin Carlsberg possesses the highest commercial importance as a proteolytic additive for detergents. Serine protease Pb92, the serine protease from the alkalophilic Bacillus strain PB92, also contains two calcium ions and the overall folding of the polypeptide chain closely resembles that of the subtilisins. Members of the peptidases S8 and S35 clan include endopeptidases, exopeptidases and also a tripeptidyl-peptidase. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The S53 family contains a catalytic triad Glu/Asp/Ser. The stability of these enzymes may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Statistics
?
PSSM-Id: 173803
View PSSM: cd07477
Aligned: 53 rows
Threshold Bit Score: 232.422
Threshold Setting Gi: 42523726
Created: 9-Oct-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
active sitecatalytic
Conserved site includes 6 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1               #                                   #                                    
1CSE_E        25 NVKVAVLDTGIQASHPd---lNVVGGASFvage--ayntDGNGHGTHVAGTVAaldntt----gvlgvAPSVSLYAVKvl 95  Bacillus subtilis
YP_857952    112 EVLVCIIDSGYSGGHPdlphgAQVQGSNDagtg--swssDENGHGTHVAGTIAavggndq-gvvgvlpNQSVPLQIVKvf 188 Aeromonas hydro...
XP_002296079  30 PVKVCIIDTGYDYGNEdl-ptDDVTSTETkygd---afiDGDGHGTHCAGVIGaigdndrgvigvnpdPTKFSLHISKal 105 Thalassiosira p...
AAF23173     162 NRKVCVIDSGYLRNHVdl-psAGVTGSTFsghg--swftDGNGHGTHVAGTIValdnnvg--vvgvlpSGLVGLHNVKif 236 Vibrio metschni...
BAF80056     172 NMSVCVIDTGYQSNHAdl-psSGVTGASFqghg--nwfsDGNGHGTHVAGTIValdnnig--vvgvlpSGLVGLHNVKif 246 Alkalimonas col...
YP_001473350 155 NRTICIIDSGYDRSHNdl-sgNNVTGTNNsgtgnwfepgNHNAHGTHVAGTIAaianneg--vvgvmpNQNANIHVIKvf 231 Shewanella sedi...
1V6C_A        23 NRTICIIDSGYDRSHNdl-naNNVTGTNNsgtgnwyqpgNNNAHGTHVAGTIAaianneg--vvgvmpNQNANIHIVKvf 99  Pseudoalteromon...
ACI49707     112 EVLVCIIDSGYSGGHPdl-phGAQVQGSNdagtg-swssDENGHGTHVAGTIAavggndq-gvvgvlpNQSVPLQIVKvf 188 Aeromonas hydro...
XP_002296222 172 PIKICIIDTGYDLGHEdl-pnNDRITSSPtdfe--naltDGDGHGTHIAGIMGaigngeg-ivginpdQSKFSFHISKal 247 Thalassiosira p...
YP_001094333 127 GIKVCVIDSGLDRSNPdf-nwGAITGDNDsgtg--dwdvNGGPHGTHVAGTIGaadngi----gvvgmAPGVDMHIIKvf 199 Shewanella loih...
Feature 1                   #                        #                            #              
1CSE_E        96 nssGSGSy-SGIVSGIEWATTng------mDVINMSLGgasgstAMKQAVDNAYARgVVVVAAAGNSgnsgstntigypa 168 Bacillus subtilis
YP_857952    189 ganGWAYs-SNLVGALNACKQgmsnrgfthMVINMSLGgsvpskTEEQAFNQAYGQnVLSVAAAGNAgntsksy----pa 263 Aeromonas hydro...
XP_002296079 106 naqGIGTa-SSLIQAIEGCMEsg------sKIISMSLGggpnsdIFREIYKEAYDEgILIFGAAGNQgstdhdy----pa 174 Thalassiosira p...
AAF23173     237 ndsGVWTraSDLIQAIQSCQSag------sHVVNMSLGgsqgsvTEQKPMRNFYQQgMLLVAAAGNSgnsgfsy----pa 306 Vibrio metschni...
BAF80056     247 ndsGNWTnaSNLIQAIQSCQNag------aKVVNMSLGggssntTERNAMNNFNNSgMLLVAAAGNAgntsfsy----pa 316 Alkalimonas col...
YP_001473350 232 neaGWGYs-SSLVSAVDTCVDng------aNVVTMSLGgsssstTEKNALTAHQDNgILLIAAAGNDgdnthsy----pa 300 Shewanella sedi...
1V6C_A       100 neaGWGYs-SSLVAAIDTCVNsg-----gaNVVTMSLGgsgsttTERNALNTHYNNgVLLIAAAGNAgdssysy----pa 169 Pseudoalteromon...
ACI49707     189 ganGWAYs-SNLVGALNACKQgmsnrgftrMVINVSLGgsvpskTEEQAFNQAYGQnVLSVAAAGNAgntsksy----pa 263 Aeromonas hydro...
XP_002296222 248 gddGKGSa-STVIEGFEGCIDag------aKVISLSLGggkrsnIQQQLFKDAYDDgILIFAASGNSgttiley----pa 316 Thalassiosira p...
YP_001094333 200 tasGWAYs-SDLAHATDLCSQag------aNIISMSLGgggassIESNAFEAFTQAgGLVVAAAGNDgnnarsy----pa 268 Shewanella loih...
Feature 1                                                                                        
1CSE_E       169 kydsVIAVGAVdsnsnra---------------sfssvgAELEVMAPGagvYSTYpt----------------------- 210 Bacillus subtilis
YP_857952    264 sygsVVSVAAIdankqla---------------yfsqrnDQVELAAPGvsvLSTVp------------------------ 304 Aeromonas hydro...
XP_002296079 175 sfphVVSVGAVnqngkra---------------pfsnfnDQVELMAPGvevLSTYpn----------------------- 216 Thalassiosira p...
AAF23173     307 sydaVVSVAAVnssgnva---------------nfsqfnSQVELSAPGvgvLSTGnn----------------------- 348 Vibrio metschni...
BAF80056     317 sydaVVSVAAVnssknla---------------sfsqrnSQVEISGPGvnvASTWnn----------------------- 358 Alkalimonas col...
YP_001473350 301 sydaVMSVAAVdnnkdha---------------afsqytNQVEIAGPGeaiLSTVtlgegrladitiggqsyfdngvvph 365 Shewanella sedi...
1V6C_A       170 sydsVMSVAAVdsnldha---------------afsqytDQVEISGPGeaiLSTVtvgegrladitiggqsyfsngvvph 234 Pseudoalteromon...
ACI49707     264 syssVVSVAAIdankqla---------------yfsqrnDQVELAAPGvsvLSTVp------------------------ 304 Aeromonas hydro...
XP_002296222 317 sypyVVSVSAVnedeeya---------------tfsnrnFQVELVGPGvgiRSTLpn----------------------- 358 Thalassiosira p...
YP_001094333 269 aypaVMMVGANdadnniasfsqfpscssgrgkhatqdemTCVEVTAGGvqtLSTYpaematiaamsaddvffeasameni 348 Shewanella loih...
Feature 1                                                                                        
1CSE_E           --------------------------------------------------------------------------------     Bacillus subtilis
YP_857952        --------------------------------------------------------------------------------     Aeromonas hydro...
XP_002296079     --------------------------------------------------------------------------------     Thalassiosira p...
AAF23173         --------------------------------------------------------------------------------     Vibrio metschni...
BAF80056         --------------------------------------------------------------------------------     Alkalimonas col...
YP_001473350 366 nryvksgtdhvatpisgsvmgelaecsvsgstfncgdmnskvclvervgnqgagypeidavracnnagasavivygnpal 445 Shewanella sedi...
1V6C_A       235 nrltpsgtsyapapinasatgalaectvngtsfscgnmankiclvervgnqgssypeinstkacktagakgiivysnsal 314 Pseudoalteromon...
ACI49707         --------------------------------------------------------------------------------     Aeromonas hydro...
XP_002296222     --------------------------------------------------------------------------------     Thalassiosira p...
YP_001094333 349 gsasgstyfmgtaetldtraqgsvcvidrgnisfhd-----------------------------kvanceasggigaii 399 Shewanella loih...
Feature 1                                                              #                         
1CSE_E       211 ---------------------------------------------nTYATLNGTSMASPHVAGAAALILSKhpnlsaSQV 245 Bacillus subtilis
YP_857952    305 ---------------------------------------------tGYAYYSGTSMATPHVVGVAALVWSQrlecsnDQL 339 Aeromonas hydro...
XP_002296079 217 ---------------------------------------------dSYFTLSGTSMATPYVAGVAALVWGYfpecsnHQI 251 Thalassiosira p...
AAF23173     349 ---------------------------------------------gGYLSYSGTSMASPHVAGVAALVWSHfpqcrpERI 383 Vibrio metschni...
BAF80056     359 ---------------------------------------------gGYNSISGTSMASPHVAGVAALVWSNhpqctnTQI 393 Alkalimonas col...
YP_001473350 446 pglqnpflvdtnneaaivsvsvdratgqalqaqvgstvtventaneDYEYYNGTSMATPHVSGVATLVWSHhtecgaAQI 525 Shewanella sedi...
1V6C_A       315 pglqnpflvdansditvpsvsvdratglalkaklgqsttvsnqgnqDYEYYNGTSMATPHVSGVATLVWSYhpecsaSQV 394 Pseudoalteromon...
ACI49707     305 ---------------------------------------------tGYAYYSGTSMATPHVVGVAALVWSQrlecsnDQL 339 Aeromonas hydro...
XP_002296222 359 ---------------------------------------------gRYGLLSGTSMATPHVAAAAALVWSHfpqcsnNQI 393 Thalassiosira p...
YP_001094333 400 vnnvdgmlygtlgdanstqipavgaalsdrtalisatqasvsiasgDYGYMSGTSMATPAVSGVAALVWSNfpectgSEI 479 Shewanella loih...
Feature 1               
1CSE_E       246 RNRLSST 252 Bacillus subtilis
YP_857952    340 RQTLRSS 346 Aeromonas hydrophila subsp. hydrophila ATCC 7966
XP_002296079 252 RNVLALT 258 Thalassiosira pseudonana CCMP1335
AAF23173     384 RQSLSQT 390 Vibrio metschnikovii
BAF80056     394 RNVLNQT 400 Alkalimonas collagenimarina
YP_001473350 526 RAALNAT 532 Shewanella sediminis HAW-EB3
1V6C_A       395 RAALNAT 401 Pseudoalteromonas sp. AS-11
ACI49707     340 RQTLRSS 346 Aeromonas hydrophila
XP_002296222 394 RNVLALT 400 Thalassiosira pseudonana CCMP1335
YP_001094333 480 RQALKAT 486 Shewanella loihica PV-4

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap