1XF1


Conserved Protein Domain Family
Peptidases_S8_C5a_Peptidase

?
cd07475: Peptidases_S8_C5a_Peptidase 
Click on image for an interactive view with Cn3D
Peptidase S8 family domain in Streptococcal C5a peptidases
Streptococcal C5a peptidase (SCP), is a highly specific protease and adhesin/invasin. The subtilisin-like protease domain is located at the N-terminus and contains a protease-associated domain inserted into a loop. There are three fibronectin type III (Fn) domains at the C-terminus. SCP binds to integrins with the help of Arg-Gly-Asp motifs which are thought to stabilize conformational changes required for substrate binding. Peptidases S8 or Subtilases are a serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Statistics
?
PSSM-Id: 173801
View PSSM: cd07475
Aligned: 29 rows
Threshold Bit Score: 293.788
Threshold Setting Gi: 169351685
Created: 15-Sep-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
catalytic triadputative active
Conserved site includes 3 residues -Click on image for an interactive view with Cn3D
Feature 1:catalytic triad [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                      #                                                  
1XF1_A          7 KTLQEka-----------gkGAGTVVAVIDAGFDKNHeawrltdktkaryq----------------------------- 46   Streptococcus...
AAK19159      194 APFGKnf------------dGRGMVISNIDTGTDYRHkamridddakasm------------------------------ 231  Streptococcus...
CAD43138      192 GLWNEgy------------qGQGMVVAVIDSGVQAHDdlrlsddstaait------------------------------ 229  Lactobacillus...
ZP_00786215   260 KAKQNsk-----------vdGRGLLIATIDSGVDIHHpamrldendpd-------------------------------- 296  Streptococcus...
ABL84353      162 KASSKyq-----------tdGRGMVIAVIDSGLDIKHkdmrlddgvi--------------------------------- 197  Streptococcus...
ZP_02043252   177 PVLKNasslamtranevvlkGDRQVIEVIDSGLQTDHdafagsmdgvdvrmsq--------------------------- 229  Actinomyces o...
ZP_02043800   190 QITQK---------------GDGKVVAVIDTGVDMTHpafagalhgtpglse---------------------------- 226  Actinomyces o...
ZP_02868623   231 AAWEAgy------------tGAGKVVGVFDSSIRYTHklfsymdpevekageagllsnyktkenlldvvkanqstlnlfv 298  Clostridium s...
YP_001986516  190 PLWDQni------------kGQGMVAAVIDQGVEPHQdfrlsdaktaals------------------------------ 227  Lactobacillus...
YP_001986517  195 PLWDEni------------kGQGMVAAVIDSAVEPHDmlrlsdnttakis------------------------------ 232  Lactobacillus...
Feature 1                                                                     #                   
1XF1_A         47 -------------skedlekakkehgITYGEWVNDKVAYYHDYskdgk------tavdqEHGTHVSGILSgnapset--- 104  Streptococcus...
AAK19159      232 --------------rfkkedlkgtdkNYWLSDKIPHAFNYYNGgkitvekyddgrdyfdPHGMHIAGILAgndteqdi-- 295  Streptococcus...
CAD43138      230 -------------kekaeaaisklgyGSYVNSKIPFAYDYVNNdsvntg----ttvagsTHGEHVAGIIAangttadgat 292  Lactobacillus...
ZP_00786215   297 ----------------vmakrrikdiKAPYTNKVPFAYNYQRGdnlelk-----ddvqrPHGMHLAGILAgnak------ 349  Streptococcus...
ABL84353      198 ----------------pkikditpstTGTYTLKVPHGYNYVSGndnly------ddthePHGMHIAGTLAgnatdeev-- 253  Streptococcus...
ZP_02043252   230 -----------advqafagklphggaGTYVNSKIPFAYDYADNdadvvp----hsekdlSHGTHVTAIAAanad------ 288  Actinomyces o...
ZP_02043800   227 -----------dkvealtpqlgdgktGSYVSEKFPFAYDYADNdpdasp-----tgeagSHGTHVAGITAgnag------ 284  Actinomyces o...
ZP_02868623   299 egwgswfhgfdetgfsedvqqdilngDFYYNSKVPFSVDYACGdldaw------dgdssSHGTHVSGIVAgnggegy--- 369  Clostridium s...
YP_001986516  228 -------------edqikaftashgyGDYVNEKIPFFYDYTKNvnenl------kfdtsNHGQHLAGIIAangqssd--- 285  Lactobacillus...
YP_001986517  233 -------------ketiadfaashgyGTYLNDKLPFFYDYTTNsntnl------hldnhIQGEQVAGIIAgngqerp--- 290  Lactobacillus...
Feature 1                                                                                         
1XF1_A        105 ---kepyrleGAXPEAQLLLXRveiv----nglADYARNYAQAIRDAInlgaKVINXSFGnaalay---anlpdeTKKAF 174  Streptococcus...
AAK19159      296 ---knfngidGIAPNAQIFSYKmysd---agsgFAGDETMFHAIEDSIkhnvDVVSVSSGftgtg-----lvgekYWQAI 364  Streptococcus...
CAD43138      293 gnekattyvkGVAPEAQILAMQvid-----efaDENANDISRAIRDAVtlgaNAIQMSLGigvteq----dltdeEQAAV 363  Lactobacillus...
ZP_00786215   350 ------dgfkGVAPNAQLLVYKistnredpsaeWTGSDAVFHAMEDAAkrgaDVISLSFGylgtg-----rpgelWYETI 418  Streptococcus...
ABL84353      254 ---askkgvdGIAPNAQLLVYKifsnd-pknykAETEDAAYAAIEDAIkhgaDVISLSVGyydsg-----lpgnaYYTIA 324  Streptococcus...
ZP_02043252   289 -------vlqGTAPHAQIVVAKvasd----edgSMLDSALLAALDDALvikpDVINLSLGddsgms---sdadsvFAGVY 354  Actinomyces o...
ZP_02043800   285 -------eivGIAPDAQIIVAKvars----sngGIPDSALLAALDDMVilhpDVVNLSLGqtggmd---neadsmYATVF 350  Actinomyces o...
ZP_02868623   370 ---deisgvkGAAYDAQIMFFKvfden--ddfgQESDEAVFAALDDAVtlgvNAFNLSLGipngfttmntyaqagYQQAY 444  Clostridium s...
YP_001986516  286 ----skkyvtGIAPEAQLLSMKilg-----kssSDSLNNAARAIYDAVdlgaNAINISFGmgvdid----dptaeGQAAI 352  Lactobacillus...
YP_001986517  291 ----dgryilGVAPEAQILSMKvlg-----qakSLTTNNVARAVYDAValgaDVIYLSLVktvdve----dptaeDQAAI 357  Lactobacillus...
Feature 1                                                                                         
1XF1_A        175 DYAKSkgVSIVTSAGNDssfggktrlpladh-----pdygvvgtpaaadsTLTVASYSpdkqltetvrvktadqqdkexp 249  Streptococcus...
AAK19159      365 RALRKagIPMVVATGNYatsasssswdlvannhlkmtdtgnvtrtaahedAIAVASAKnqtvefdkvniggesfkyrnig 444  Streptococcus...
CAD43138      364 QYATDhgVFVSISAGNNanagsiigsktsndi----stayspkndstigdPGAAASAMtv-------------------- 419  Lactobacillus...
ZP_00786215   419 KKVTDkgVIVVAAMGNYgnsassttydnvvdnslgtkdtaamvsvaavdkVIGVGSVQnsallldvlkvgnlklgyaelg 498  Streptococcus...
ABL84353      325 KRAAEkgIIITAAIGNAgasssdtsfdlhtnnalgavdtattvgvaatpaVIAVGSARnthlvqrefmlngqsfgyypig 404  Streptococcus...
ZP_02043252   355 EKLAAagITVNAAGGNAfsnaygnnsgqnkpfa-tdpdtgtlgepasyksTLAVASVDnqealsyvslgdrtiayrtaln 433  Actinomyces o...
ZP_02043800   351 KSLQDagVTVNAAAGNEytagygnlsgknlpfa-sdpdssvlcepasyssVVSVASVDnslahsaftvgdrdiayqragg 429  Actinomyces o...
ZP_02868623   445 NRAHAsgITINISAGNDardshpgalvngyttl--lpnssaggfsgslyaPMTVASAQgigysyinkytettatavnsns 522  Clostridium s...
YP_001986516  353 KFATDhgVFVTVATGNNghaggiydksasn--------gittsyhpanasTLTTPSATpsam------------------ 406  Lactobacillus...
YP_001986517  358 QFATDhgVLVIKTTSNNgnamaihgt---------------svpggttagYITTNNSTlsltgggl-------------- 408  Lactobacillus...
Feature 1                                                                                         
1XF1_A        250 vlstnrfepnkaydyayanrgtkeddfkdvkgkialiergdi-------------------------------------- 291  Streptococcus...
AAK19159      445 affdkskittnedgtkapsklkfvyigkgqdqdligldlrgkiavmdriytkdlknafkkamdkgaraimvvntvnyynr 524  Streptococcus...
CAD43138          --------------------------------------------------------------------------------      Lactobacillus...
ZP_00786215   499 hksqtilkmlknktfdlvyvgkgqlkkdiseedlxsytgkvivverggegvk---------------------------- 550  Streptococcus...
ABL84353      405 yttltegkyefvdagnghweevqgldlagkvavikkdkfdlkdavrnlk------------------------------- 453  Streptococcus...
ZP_02043252   434 gqgeavrglrdvpektyrivdagaggtdrleqhagtdlsgvivledkggtdsrdg------------------------- 488  Actinomyces o...
ZP_02043800   430 adgqkmpdlsdltggpfeyvdggigspedgealkakypeglagkivlv-------------------------------- 477  Actinomyces o...
ZP_02868623   523 etvntimisdlyspalgevlngtyelvdcgdgssitqdltgkvalvkrvygyvpyde----------------------- 579  Clostridium s...
YP_001986516      --------------------------------------------------------------------------------      Lactobacillus...
YP_001986517      --------------------------------------------------------------------------------      Lactobacillus...
Feature 1                                                                                         
1XF1_A        292 -------------------------dfkdkiakakkagavgvliydnqdkgfpielpnvdqxpaafisrkdglllkdnpq 346  Streptococcus...
AAK19159      525 dnwtelpamgyeadegtksqvfsisgddgvklwnminpdkktevkrnnkedfkdkleqyypidmesfnsnkpnvgdekei 604  Streptococcus...
CAD43138          --------------------------------------------------------------------------------      Lactobacillus...
ZP_00786215   551 ----------------dklkrfigiakgviminepayyssgnfdthpmfdyhydipegkwaislskkdgdqlidyikknk 614  Streptococcus...
ABL84353      454 ------------------fkdvagiivintdqgwnkdyyrthqllvddktllsyssiwgislsgedgrrllevanqsqgn 515  Streptococcus...
ZP_02043252   489 -------------samteelkarnltalspapaalmvadtdeadtpyqailgsttsmptvtitkrdgeairealaaanga 555  Actinomyces o...
ZP_02043800   478 --------------------krgsltfqdkfnniagskpagfivynnvpgdslvvmslatdgvpaafisqadgeamlaaa 537  Actinomyces o...
ZP_02868623   580 ----------agiiaaqenaykagavavymtfdyysdyfgtnglwtgasgesipvfagtatssdvynalvsaiangtvnv 649  Clostridium s...
YP_001986516      --------------------------------------------------------------------------------      Lactobacillus...
YP_001986517      --------------------------------------------------------------------------------      Lactobacillus...
Feature 1                                                                          #              
1XF1_A        347 ktitfnatpKVLPTASGTKLSRFSSWGLTADGNIKPDIAAPGQDILSSvan-----nkyAKLSGTSXSAPLVAGIXGLLQ 421  Streptococcus...
AAK19159      605 dfkfapdtdKELYKEDIIVPAGSTSWGPRIDLLLKPDVSAPGKNIKSTlnvin-gkstyGYMSGTSMATPIVAASTVLIR 683  Streptococcus...
CAD43138      420 -------aaEKSATGDKSEMDGFSSWGPMADYTLKPDISAPGDNVISTaidpttntqtyATESGTSMAGPYNAGAALLVM 492  Lactobacillus...
ZP_00786215   615 takleflpkETFVRRPNPTISGFSSWGVTPDLHLKPDVVAPGEDIYSTfnd-----gtyGYMSGTSMATPQVAAISALVK 689  Streptococcus...
ABL84353      516 tglvlkptiGMKKLIEVPTVSGFSSWGPTVNLELKPEIVAPGEDVYATlnd-----nryGSMSGTSMASPIVAGASALLL 590  Streptococcus...
ZP_02043252   556 dvtvtvthsGIVLASNNPTASEFSAWGVAPDLTLKPEIAAPGGDIMSAylg-----neyQRLSGTSMASPQVAGISALVR 630  Actinomyces o...
ZP_02043800   538 dhhlsvapgKVVPPSSKYSMSSFSSWGVTPDLRLKPEVSAPGGNIYSAvpg-----gtyEFMSGTSMATPQMAGVSAVVL 612  Actinomyces o...
ZP_02868623   650 tfssedkseTITRNYNDNGPAGSTSWGVSESMNLKPDVMAPGGNIWSAgass---dtalSSKSGTSMASPNAEGLFILAQ 726  Clostridium s...
YP_001986516  407 -----avaaGNDVLDPKAALISASSWGPTASYKLKPDITAPGEKVASTlln-----dglGKVSGTSQANAYVTGASLLVM 476  Lactobacillus...
YP_001986517  409 --saltvasENSALGTKSAMAYNSSWGPTTDYKLKPDLTTPGEKSVSIgkn-----nalATKSGTAAASAYAAGAGLLVM 481  Lactobacillus...
Feature 1                                                                                
1XF1_A        422 KQyetqy--------pdxtPSERLDLAKKVLXSSat-------alYDEDEKAYFSPRqQGAGAVDAKKASA 477  Streptococcus pyogenes
AAK19159      684 PKlkemlerpvlknlkgddKIDLTSLTKIALQNTarpmm--datsWKEKSQYFASPRqQGAGLINVANALR 752  Streptococcus pneumoniae
CAD43138      493 QKikatr--------pdlqGADLVKAVKLALMNAadp------mkDINYPDTYISPRrQGAGQIDVSKAGD 549  Lactobacillus rhamnosus
ZP_00786215   690 SKvaeimal----klpmlaGLTNVDLTKIVLMNTsqp------lkDTLNKALEISPRrQGAGMVNLEKALA 750  Streptococcus agalacti...
ABL84353      591 PRirqm---------tppeGMTRMDLLRIILMNTatpl---vdvlDSSGHALENSPRqQGAGLLQIDRAFE 649  Streptococcus suis
ZP_02043252   631 ERlagdpa------fsgmsAEQKNAVVTNLLMGTahp-----lidVELSDGTYYSPRrVGAGAVDALAATT 690  Actinomyces odontolyti...
ZP_02043800   613 QRvqndpl------fasmsAREKVDVVQNLIMSTaap-----ivdPLQDTGAPYSPRkQGSGLANVLAATT 672  Actinomyces odontolyti...
ZP_02868623   727 QYvddnldt----fgvktgTHEYVELINQLVASTaiayqpfvsseDLTRQNLYFSPRrQGAGMANIENVIN 793  Clostridium spiroforme...
YP_001986516  477 QNlkrs---------tnltGAQLVKAVKLALMNAanp------ilDINYPGQIISPRrQGAGQIDVAKAAN 532  Lactobacillus casei BL23
YP_001986517  482 QHlkqt---------tkltGVELVKAVKLALMNAatp------mmDHDYPGNFVSPRrQGAGQIDVAKASG 537  Lactobacillus casei BL23

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap