Conserved Protein Domain Family
Peptidases_S8_subtilisin_Vpr-like

?
cd07474: Peptidases_S8_subtilisin_Vpr-like 
Peptidase S8 family domain in Vpr-like proteins
The maturation of the peptide antibiotic (lantibiotic) subtilin in Bacillus subtilis ATCC 6633 includes posttranslational modifications of the propeptide and proteolytic cleavage of the leader peptide. Vpr was identified as one of the proteases, along with WprA, that are capable of processing subtilin. Asp, Ser, His triadPeptidases S8 or Subtilases are a serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Statistics
?
PSSM-Id: 173800
View PSSM: cd07474
Aligned: 21 rows
Threshold Bit Score: 184.841
Threshold Setting Gi: 116625240
Created: 18-Sep-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
catalytic triadputative active
Feature 1:catalytic triad [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                  #                                                                      
AAG48355       73 GKGVKVAVIDTGIDYRHpdlq------------------------------anykGGYDvvdYDHDPmetqst------- 115  Bacillus pseu...
NP_968340     182 GQGMRVGVIDTGVDYTHkmlggegteeaykav--------npnethpsfpnkkvvGGIDivgSEYNSgapnplkrip--- 250  Bdellovibrio ...
YP_001951957  197 GTGIRIGIIDTGIDYTHahfgggt------------------------fpnskvkGGWDfvgDAYNGsntpvpd------ 246  Geobacter lov...
YP_001854054  185 GKGVKVAVIDSGVDYTHadfggpgttdgykkakas---tdmpakdsglydpekflGGYDlagDAYDArvassvpkpd--- 258  Kocuria rhizo...
YP_001275908  158 GNGVRIGIIDSGIDYTHatfggpgtpdafrsnd-------ptiieagtfptekiiAGYDfvgDAYDAsgrigspipnpdp 230  Roseiflexus s...
YP_001635513  178 GKDVRVAVLDSGIDYTHaafggpgtleayqaaygtspsdsrnktldglfptdrvkGGYDfvgEVWPNgplapdpdpidc- 256  Chloroflexus ...
ABZ10055       39 GSGIVVSIIDTGIDLNHpdle------------------------------gkiiGGYDfvdNDEMPed----------- 77   uncultured ma...
YP_001918523  194 GAGVNVAILDTGVDYTHsalgegf------------------------gdghkvvDGYDfvnRRRYPmd----------- 238  Natranaerobiu...
YP_827915     139 GAGIRIGIIDTGIDQNHpgfqdss------------------------lkppagfPAGDaafTNNKVivarsyvsllndt 194  Solibacter us...
YP_827396     133 GAGIKIGMIDSGVDVNNpafgdllpp---------------------vdgfpkvrSAADtrfTNAKIivarnytpllp-- 189  Solibacter us...
Feature 1                            #                                                            
AAG48355      116 -------------qgvptLHGTHVAGIIAang--------------------------------qvkGVAPEADIYAYRa 150  Bacillus pseu...
NP_968340     251 --------vpdanpldeaTHGTHVAGTVAgvgdg----------------------------vntydGVAPDADLYAIKv 294  Bdellovibrio ...
YP_001951957  247 -----------nnpmdcyGHGSHVAGSAAgfgvktdgttyvesgadtyaglkdlsaadytskfriapGVAPKADLYALRv 315  Geobacter lov...
YP_001854054  259 ---------tnpldceagGHGTHVAGTIGgygvgedgktfkgdh--------tkltkdqvlkmkigpGTAPGAQLIGLRv 321  Kocuria rhizo...
YP_001275908  231 dpldcagdgadavrrisgGHGTHVASIAAgygvdaagrtyrgl----------ysgsvsyadflvapGVAPGASLVALKv 300  Roseiflexus s...
YP_001635513  257 ------gapglssgtcagGHGTHVADIIGge-----------------------------------qGVAPEVDLFAVKv 295  Chloroflexus ...
ABZ10055       78 ----------------tnGHGTQVAGIIAang--------------------------------nlkGIAPNSKILMYKv 109  uncultured ma...
YP_001918523  239 ----------------deGHGTHVAGIIAadg--------------------------------efqGIAPKANILAYKv 270  Natranaerobiu...
YP_827915     195 dp--tystpddfsardrqGHGTAIAMIAAgvqhsa--------------------------plgtisGVAPKAFLGNYKv 246  Solibacter us...
YP_827396     190 -------dggdadandhdGHGTGTALAAAggtast--------------------------pygvvtGVAPKAYIGSYKv 236  Solibacter us...
Feature 1                                                                                         
AAG48355      151 lg-pggQGTTEQVIEAIEKAVad---------gvDVLNLSLGntvng---------------pdwpTSVALDKAVEegVV 205  Bacillus pseu...
NP_968340     295 fg-akgSTSDEVVIAALEYAAdptgdl-tfqkqlDVVNLSLGsgygn---------------phimYNHAIKNLVRggTV 357  Bdellovibrio ...
YP_001951957  316 f---gcTGSTNVTEQAIEWAMdpngdg-dtsdhlDVINMSLGsafgs---------------eydtSAVAANNAALagVI 376  Geobacter lov...
YP_001854054  322 f---gcEGSTNLVLEALDRALdpnmdg-dfsdkaDIINMSLGsdfgp---------------addpQNDVIDALSRqgIL 382  Kocuria rhizo...
YP_001275908  301 f---gcRGTTTFLTRAIDYAIdpngdgntddrlvDVLNISLGspfgg---------------endpDVVAINRAVDagVV 362  Roseiflexus s...
YP_001635513  296 csavssSCSGVAILQGLDWSAdpngdg-vtddrmHIVNMSLGasygq--------------nydddSAIAVDNLQPlgIL 360  Chloroflexus ...
ABZ10055      110 se-dgeSVPSHLIIKAIEKSIed---------gaDIINISLGinqt-----------------ntkIDQAVNKAVKnnIF 162  uncultured ma...
YP_001918523  271 ld-ehgEGSTDDILAALDQIVrdrrrg--sanaaDIINMSFGsrqey---------------vgslIADALESAVDegIS 332  Natranaerobiu...
YP_827915     247 fg--apGVNEYTLFPAWNQALtdai-----ndgmDIVTLSLGegdpaivgpldvgvavcgddicdvRSQAVESATKlgLL 319  Solibacter us...
YP_827396     237 ld--anGGTSDVIAKAIDDAVad---------gmDVINISLGsyvtsys----------didpgevGMAAIARAAKagVI 295  Solibacter us...
Feature 1                                                                                         
AAG48355      206 AVTSNGNSgpkmwtvg------spgtstkAISVGASAppiktpyatvfgddkeltlfpmggtmpwalkrdfplvdgglgt 279  Bacillus pseu...
NP_968340     358 VVAAAGNSgdlpyivg------apsvsddAISVANSIdnmnqnvlfpaaefavngealiveategaitkpladvtdlkae 431  Bdellovibrio ...
YP_001951957  377 VVASAGNDgdinyitg------spavasyAVSVANSVdsgaigsafevtattapsatmpvglysgveaafgpqtfsqtgd 450  Geobacter lov...
YP_001854054  383 SVIAAGNAgdaheisg------spgsarsALTVANSQgstavqdkaeglspdsakgeltgsysgsydyqgakpedlqgdv 456  Kocuria rhizo...
YP_001275908  363 VVVAAGDTggtfyain------spssagkAIAVGASVd------------------------------------------ 394  Roseiflexus s...
YP_001635513  361 VVASAGNSadrpyitg------tpagartALSVAQTAvpsdasypitvlsttvygiaqpwapipntpvngtlvygaslgn 434  Chloroflexus ...
ABZ10055      163 VVTAAGNFgpelntig------spginpnAITVGATFnnvtnslvstfeiegktfnvfpmvgtqslaepitsqiifgkyg 236  uncultured ma...
YP_001918523  333 VVMAGGNEgprsstldfp--nyfpqhndsIITVGSSGagaqevnisasgisgfiygelmlyspapdidgsarieyieggn 410  Natranaerobiu...
YP_827915     320 VVAAAGNGgdigtkfptqnslntpgvapsALTVGASMnrhllyqrvrvngsslgdlralfgdgpkisspvntqvadvatl 399  Solibacter us...
YP_827396     296 VVVAAGNQgpaagtia------dyasapdAITVGAIHndrslgygieatgiapypayagdgpnpgqaiggtlfdltaldp 369  Solibacter us...
Feature 1                                                                                         
AAG48355      280 eedldelevegsvllvkrgli--------------------pftekahnakkagakamiiynnlpgafvgvveggvklpv 339  Bacillus pseu...
NP_968340     432 lvyigtaakpldeatkarllgkiafidrg-----evnfsvkiqvaqdngaigvvvannaegapivmggdgkfdipgimid 506  Bdellovibrio ...
YP_001951957  451 lvyaspaigcstitnnvsgkialidrgtcsfatkvkfaqdagalgvlivnnvssfpfamsddgtgasitipsmmtyqaig 530  Geobacter lov...
YP_001854054  457 vaapadnkfgcspfsqnfagkwvmldwedngpfpcgskvrfdnvaaaggkgvvlesdytvdpsaiagnakipgllmgkks 536  Kocuria rhizo...
YP_001275908      --------------------------------------------------------------------------------      Roseiflexus s...
YP_001635513  435 algctaypagsltgqillvdrgvcaisi------kgsngaaagavavivannaagavpptfsfgggtptvpvlsitqaag 508  Chloroflexus ...
ABZ10055      237 rvhdllennfegsilliergsdiene----------ivyfsdkeknaadvgakaivvynnepgiffgeliheyvdegynp 306  uncultured ma...
YP_001918523  411 nysdftnwagesyvedkialv--------------------ergegtyremaenaaragakaliiynndpgmfygslvep 470  Natranaerobiu...
YP_827915     400 gndgqactalpagsltgvyaliqrgtcayan-kinnaqaagatgvilynsdgnqditqrlfaentgipaalignndglal 478  Solibacter us...
YP_827396     370 sglacaalpegsvagkivlvlrgtct----------fesklndaaaggalgivvynnpgnnsfstggvtvgsatlpalfv 439  Solibacter us...
Feature 1                                                                                         
AAG48355      340 vsvtkedgeylldkleeahkeltirTIYREEEDFIAPFSSRGPVTQTWEVKPDLVAPGVSIDSTvpr-----------gy 408  Bacillus pseu...
NP_968340     507 ltsakrikaalaqgpveanlkttaqIEKPWMADTISPSSSRGPRSEDGIIKPEISAPGTNIISAasga--------gekg 578  Bdellovibrio ...
YP_001951957  531 tnlkadlgtgtvtvlltsahrnslvMQDSSIEDTVSSSSSRGLARLGSRLKPDIAAPGDTIFSVktgs--------gnqg 602  Geobacter lov...
YP_001854054  537 vdkikpavqaggakiklapewvgaaRAETGNKDQVNDSTSRGQHGSNGVIKPDVAAPGTNIGSAgvaq--------gngv 608  Kocuria rhizo...
YP_001275908  395 ------------------------aGRDPSLSPDSLDLLTSRGPQRSRQLKPDLVAPGVALRSAaags--------giga 442  Roseiflexus s...
YP_001635513  509 nalkarvgnattigfdtpatnagsvVGTSSRGPTLGQMTYGDQIMYGQIIKPEIGAPGASLSAVagsg---------tgv 579  Chloroflexus ...
ABZ10055      307 tipalslsredglvikeilqsdtkgVLDVFYHPDFVAYFSSRGPVSPFYIKPDIVAPGAFINTTdtn----------gny 376  uncultured ma...
YP_001918523  471 kdyiptisisrgdgleirnqlnegnVWVRMSNNSRIANFSSRGPSSESTVKPDLVAPGKNVMSTwtq----------ddy 540  Natranaerobiu...
YP_827915     479 kqyltanpkgtvtldpamqaadnpqVNTVAPFSSRGPSIGNFAATRDFALKPEIVAPGTDVYTAtqkfdpngdtynatgy 558  Solibacter us...
YP_827396     440 nqsdgldlkaraaqdgglqvtldfsGAIAFPARTDVSSFSSRGPSLGSALKPDLAAVGEEIVTGaqnsfsggesysasgf 519  Solibacter us...
Feature 1               #                                                                  
AAG48355      409 LALNGTSMSAPHVAGAAALVKQAh-PDWSPEQIKAALMNSAKKLTSPegery------lpheqGAGRLQVDDA 474  Bacillus pseudofirmu...
NP_968340     579 ATMTGTSMASPHIAGVMALLKQKy-NTLSPAELKSVLLAHGKVIHAAdkkvy------svsrqGAGRVQVAES 644  Bdellovibrio bacteri...
YP_001951957  603 TSMSGTSMASPHVAGMMALLKQIh-PTWSVTELKALAMNTAANDLFTgtnktgn--kytpsriGAGRVSTVNA 672  Geobacter lovleyi SZ
YP_001854054  609 SIKTGTSMATPHVAGIAALVQQKh-QNYDPQHVKAAIMNSAVHDVHAangats-----avdrvGSGRVDARRA 675  Kocuria rhizophila D...
YP_001275908  443 LALSGTSIATPQVAGAAALLRQLr-PSWSPAQIKVALMNAAVPTRDAagnly------ppslaGAGRLDASRL 508  Roseiflexus sp. RS-1
YP_001635513  580 EPFGGTSGAAPMVAGAAALLYNAvdWSFAPWELKARLINTAETNIFNgppvfvgpalapitriGGGEVRINRA 652  Chloroflexus auranti...
ABZ10055      377 KISSGTSFAAPHVAGTAALILQKn-PQLSPQELKSILMTTSKIVYDQfddrf------pievsGNGRIDASKA 442  uncultured marine cr...
YP_001918523  541 SWSEGTSVSAAFVSGTVALMRQHn-PGWSPDWVKSALMNSAEPLSDSagrny------dpttqGAGELRVHSA 606  Natranaerobius therm...
YP_827915     559 TRVSGTSYAVPFAAGVAAMVKAKn-PKWTPGQLKSAVVNTATMSDLQgtvh--------vtdaGAGKLNATDA 622  Solibacter usitatus ...
YP_827396     520 VDTAGTSFSAPLAAGAAAVLKGAr-PGLTGQQYRSLLVNGAAAATVSdgvaa------tasqaGAGILNLLAA 585  Solibacter usitatus ...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap