Conserved Protein Domain Family
CRD_FZ1

?
cd07465: CRD_FZ1 
Cysteine-rich Wnt-binding domain (CRD) of the frizzled 1 (Fz1) receptor.
The cysteine-rich domain (CRD) is an essential extracellular portion of the frizzled 1 (Fz1) receptor, and is required for binding Wnt proteins, which play fundamental roles in many aspects of early development, such as cell and tissue polarity, neural synapse formation, and the regulation of proliferation. Fz proteins serve as Wnt receptors for multiple signal transduction pathways, including both beta-catenin dependent and -independent cellular signaling, as well as the planar cell polarity pathway and Ca(2+) modulating signaling pathway. CRD containing Fzs have been found in diverse species from amoebas to mammals. 10 different frizzled proteins are found in vertebrata.
Statistics
?
PSSM-Id: 143574
View PSSM: cd07465
Aligned: 3 rows
Threshold Bit Score: 274.238
Threshold Setting Gi: 17432982
Created: 23-Jan-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                # ### ###                                                            
Q9UP38    112 DHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLC 191 human
O57328     66 DHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLC 145 chicken
Q9I9M5     47 DHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELKFFLCSIYAPVCTVLEQALPPCRSLC 126 African clawed frog
Feature 1                                                    
Q9UP38    192 ERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTP 238 human
O57328    146 ERARQGCEALMNKFGFQWPDTLRCEKFPVHGAGELCVGQNASERGTP 192 chicken
Q9I9M5    127 DRARQGCEALMNKFGFQWPESLRCEKFPINGAGELCVGQNTTESGTP 173 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap