Conserved Protein Domain Family
CRD_FZ10

?
cd07462: CRD_FZ10 
Cysteine-rich Wnt-binding domain (CRD) of the frizzled 10 (Fz10) receptor.
The cysteine-rich domain (CRD) is an essential extracellular portion of the frizzled 10 (Fz10) receptor, and is required for binding Wnt proteins, which play fundamental roles in many aspects of early development, such as cell and tissue polarity, neural synapse formation, and the regulation of proliferation. Fz proteins serve as Wnt receptors for multiple signal transduction pathways, including both beta-catenin dependent and -independent cellular signaling, as well as the planar cell polarity pathway and Ca(2+) modulating signaling pathway. CRD containing Fzs have been found in diverse species from amoebas to mammals. 10 different frizzled proteins are found in vertebrata. The cellular functon of Fz10 is unknown.
Statistics
?
PSSM-Id: 143571
View PSSM: cd07462
Aligned: 4 rows
Threshold Bit Score: 294.619
Threshold Setting Gi: 16508271
Created: 23-Jan-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                # ### ###                                                            
Q9ULW2     30 GDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVM 109 human
Q9W742     30 GEGRCQAIEIPMCKDIGYNMTRMPNLMGHENQKEAAIQLHEFAPLVEYGCHSHLKFFLCSLYAPMCTEQVSTPIPACRVM 109 African clawed frog
Q9PWH2     34 GDGRCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLKFFLCSLYAPMCTEQVSTPIPACRVM 113 chicken
CAD10102   31 GEGRCQEIAIPLCKDIGYNLTVMPNLMGHEDQNEAAIKLHEFAPLIEFGCHSHLKFFLCSLYAPMCTEQVSTPIPACRVM 110 zebrafish
Feature 1                                                    
Q9ULW2    110 CEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSD 156 human
Q9W742    110 CEQARLKCSPIMEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGTD 156 African clawed frog
Q9PWH2    114 CEQARLKCSPIMEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSD 160 chicken
CAD10102  111 CEQARQKCSPIMEQFNFHWPESLDCSRLPNKNDPNYLCMEAPNNGTD 157 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap