1IJY


Conserved Protein Domain Family
CRD_FZ8

?
cd07461: CRD_FZ8 
Click on image for an interactive view with Cn3D
Cysteine-rich Wnt-binding domain (CRD) of the frizzled 8 (Fz8) receptor.
The cysteine-rich domain (CRD) is an essential extracellular portion of the frizzled 8 (Fz8) receptor, and is required for binding Wnt proteins, which play fundamental roles in many aspects of early development, such as cell and tissue polarity, neural synapse formation, and the regulation of proliferation. Fz proteins serve as Wnt receptors for multiple signal transduction pathways, including both beta-catenin dependent and -independent cellular signaling, as well as the planar cell polarity pathway and Ca(2+) modulating signaling pathway. CRD containing Fzs have been found in diverse species from amoebas to mammals. 10 different frizzled proteins are found in vertebrata. Xenopus Fz8 is important in Wnt/beta-catenin signaling pathways controlling the transcriptional activation of target genes Siamois and Xnr3 in the animal caps of late blastula.
Statistics
?
PSSM-Id: 143570
View PSSM: cd07461
Aligned: 4 rows
Threshold Bit Score: 279.174
Threshold Setting Gi: 15826376
Created: 23-Jan-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
putative Wnt
Conserved site includes 7 residues -Click on image for an interactive view with Cn3D
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                # ### ###                                                            
1IJY_A      6 KELACQEITVPLCKGIGYEYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSV 85  house mouse
O93274     24 KELSCQEITVPLCKDIGYNYTYMPNQFNHDTQDEAGMEVHQFWPLVVIHCSPDLKFFLCSMYTPICLEDYKKPLPPCRSV 103 African clawed frog
AAF21645   26 KEITCQEIAVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSV 105 zebrafish
CAF97764   25 KERQCQEITVPLCKGIGYNHTYMPNQFNHDTQDEAGLEVHQFWPLVEIKCSPDLRFLLCSMYTPICLEDYKKPLPPCRSV 104 Tetraodon nigrovir...
Feature 1                                                  
1IJY_A     86 CERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYERTD 130 house mouse
O93274    104 CERARAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYYNRT 148 African clawed frog
AAF21645  106 CERAKAGCAPLMRQYGFPWPDRMRCDLLPVQGAPDTLCMDYNRTD 150 zebrafish
CAF97764  105 CERAKAGCAPLMRQYGFPWPDRMRCELLPEQGNKDTLCMDYNRSQ 149 Tetraodon nigroviridis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap