Conserved Protein Domain Family
CRD_FZ5

?
cd07460: CRD_FZ5 
Cysteine-rich Wnt-binding domain (CRD) of the frizzled 5 (Fz5) receptor.proteins.
The cysteine-rich domain (CRD) is an essential extracellular portion of the frizzled 5 (Fz5) receptor, and is required for binding Wnt proteins, which play fundamental roles in many aspects of early development, such as cell and tissue polarity, neural synapse formation, and the regulation of proliferation. Fz proteins serve as Wnt receptors for multiple signal transduction pathways, including both beta-catenin dependent and -independent cellular signaling, as well as the planar cell polarity pathway and Ca(2+) modulating signaling pathway. CRD containing Fzs have been found in diverse species from amoebas to mammals. 10 different frizzled proteins are found in vertebrata. Fz5 plays critical regulating roles in the yolk sac and placental angiogenesis, in the maturation of the Paneth cell phenotype, in governing the neural potential of progenitors in the developing retina, and in neuronal survival in the parafascicular nucleus.
Statistics
?
PSSM-Id: 143569
View PSSM: cd07460
Aligned: 4 rows
Threshold Bit Score: 297.699
Threshold Setting Gi: 148224295
Created: 23-Jan-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   # ### ###                                                            
NP_001079217  29 KAIVCQEITVPMCKGIGYNHTYMPNQFNHDTQDEAGMEVHQFWPLVVIQCSLDLKFFLCSMYTPICLPDYRKPLPPCRSV 108 African clawed ...
Q13467        29 KAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSV 108 human
XP_002187572  27 KALVCQEITVPMCKGIGYNLTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLSDYTKPLPPCRSV 106 Taeniopygia gut...
XP_001370103  40 KALVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYPKPLPPCRSV 119 gray short-tail...
Feature 1                                                        
NP_001079217 109 CERAKAGCSPLMRKYGFAWPERMNCDRLPEHGDPd-tLCMYYNWTETT 155 African clawed frog
Q13467       109 CERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDaevLCMDYNRSEAT 156 human
XP_002187572 107 CERAKAGCSPIMQQYGFAWPERMSCDSLPVLGDTe-vLCMGYNHTEAT 153 Taeniopygia guttata
XP_001370103 120 CERAKAGCSPLMRQYGFAWPERMNCDRLPVLGDAe-tLCMDYNRSEST 166 gray short-tailed opossum

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap