Conserved Protein Domain Family
CRD_FZ3

?
cd07449: CRD_FZ3 
Cysteine-rich Wnt-binding domain (CRD) of the frizzled 3 (Fz3) receptor.
The cysteine-rich domain (CRD) is an essential extracellular portion of the frizzled 3 (Fz3) receptor, and is required for binding Wnt proteins, which play fundamental roles in many aspects of early development, such as cell and tissue polarity, neural synapse formation, and the regulation of proliferation. Fz proteins serve as Wnt receptors for multiple signal transduction pathways, including both beta-catenin dependent and -independent cellular signaling, as well as the planar cell polarity pathway and Ca(2+) modulating signaling pathway. CRD containing Fzs have been found in diverse species from amoebas to mammals. 10 different frizzled proteins are found in vertebrata. Fz3 plays a vital role in the anterior-posterior guidance of commissural axons. Knockout mice without Fz3 show defects in fiber tracts in the rostral CNS.
Statistics
?
PSSM-Id: 143558
View PSSM: cd07449
Aligned: 5 rows
Threshold Bit Score: 293.068
Threshold Setting Gi: 112363134
Created: 23-Jan-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   # ### ###                                                            
Q9NPG1        24 SLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLC 103 chimpanzee
Q61086        24 SLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLC 103 house mouse
O42579        23 SLFACEPITLRMCQDLPYNSTFMPNLLNHYDQQTAALAMEPFHPMVNLECSRDLRPFLCALYTPVCMEYGRMTLPCRKLC 102 African clawed ...
XP_420029     24 SLFSCEPIILRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVNLECSRDFRPFLCALYAPVCMEYGRVTLPCRRLC 103 chicken
NP_001036226  26 SMFSCEPITLRMCQGLAYNTTFMPNLLNHYDQQTAALAMEPFHPMVNLECSTEIRPFLCALYAPVCTEYGRVTLPCRRLC 105 zebrafish
Feature 1                                                       
Q9NPG1       104 QRAYSECSKLMEMFGVpWPEDMECSRFPDCDEPYPRLVDLNLAGEPT 150 chimpanzee
Q61086       104 QRAYSECSKLMEMFGVpWPEDMECSRFPDCDEPYPRLVDLNLVGDPT 150 house mouse
O42579       103 QRAYNECFKLMEMFGVpWPEEMECSRFPDCDEPYPRIVDISLSGEPS 149 African clawed frog
XP_420029    104 QRAYSECSKLMEMFGVsWPEDMECTRFPDCDEPYPRLVDLSLGGEPT 150 chicken
NP_001036226 106 QRAKSDCYKLMEMFGVsWPDEMECSRFPECEESYPRAIDLLPSSDST 152 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap