Conserved Protein Domain Family
CRD_FZ4

?
cd07448: CRD_FZ4 
Cysteine-rich Wnt-binding domain of the frizzled 4 (Fz4) receptor.
The cysteine-rich domain (CRD) is an essential extracellular portion of the frizzled 4 (Fz4) receptor, and is required for binding Wnt proteins, which play fundamental roles in many aspects of early development, such as cell and tissue polarity, neural synapse formation, and the regulation of proliferation. Fz proteins serve as Wnt receptors for multiple signal transduction pathways, including both beta-catenin dependent and -independent cellular signaling, as well as the planar cell polarity pathway and the Ca(2+) modulating signaling pathway. CRD containing Fzs have been found in diverse species from amoebas to mammals. 10 different frizzled proteins are found in vertebrata. Frizzled 4 (Fz4) activates the Ca(2+)/calmodulin-dependent protein kinase II and protein kinase C of the Wnt/Ca(2+) signaling pathway during retinal angiogenesis. Mutations in Fz4 lead to familial exudative vitreoretinopathy (FEVR), a hereditary ocular disorder characterized by failure of the peripheral retinal vascularization. In addition, the interplay between Fz4 and norrin as a receptor-ligand pair plays an important role in vascular development in the retina and inner ear in a Wnt-independent manner.
Statistics
?
PSSM-Id: 143557
View PSSM: cd07448
Aligned: 11 rows
Threshold Bit Score: 243.138
Threshold Setting Gi: 74962066
Created: 23-Jan-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                  # ### ###                                                             
Q9ULV1        42 ERRCDPIRisMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSS-QLQFFLCSVYVPMCTEKIni-pIGPCGG 119 human
Q9PT62        28 ERSCDPIRitMCQNLGYNVTKMPNLVGHELQADAELQLTTFTPLIQYGCSS-QLQFFLCSVYVPMCTEKIni-pIGPCGG 105 African clawed ...
Q9IA05        30 ERRCDAIRiaMCQNLGYNVTKMPNLVGHELQADAELQLTTFTPLIQYGCSS-QLQFFLCSVYVPMCTEKIni-pIGPCGG 107 chicken
Q9NBW1        43 FRQCETIRieMCRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSS-QLKLFLCAAYVPMCTPKApvhaIGPCRS 121 fruit fly
Q10662        23 GQRCQKVDheMCNDLPYNLTSFPNLVDEESWKDASESILTYKPLLSVVCSE-QLKFFLCSVYFPMCNEKLan-pIGPCRP 100 Caenorhabditis ...
CAF96654      31 EMTCDPIRisMCQGLGYNVTKMPNLVGNVLQSDAELQLTTFTPLIQYGCSS-QLKFFLCSVYVPMCTDKVpi-pIGPCGS 108 spotted green p...
EEC00899      38 GRMCEPIRieMCKDIGYNVTGMPNLVGHELQQDAQLQLQTFKPLVQYGCAS-QLKFFLCSVYVPMCTEKVaq-pIGPCRP 115 black-legged tick
XP_002237646  33 QYSCDPIRidMCNNLGYNVTRMPNLVGHDMQQDAELQLQTFTPLIQYGCSS-QLQFFLCSVYVPMCTEKVpi-pIGPCQS 110 Florida lancelet
NP_001071724  53 DNRCEPIQikMCQGLGYNATRMPNRFGQYRQTEAGIELNSYQVLLQYNCSS-ELPMFLCAAFLPMCEPGLer-tIGPCEG 130 Ciona intestinalis
XP_788346     30 TVMCEPITikLCQGVGYNMTRMPNLVGHELQQDAELQLQTFTPLIQYGCSP-FLRFFLCSVYAPYCTDKIdv-pISVCRP 107 purple urchin
XP_001622965   1 DWKCEKISidLCRSVGYNVTRMPNLIGHETQKEAESQLKQFLPLIQYGCAReQLVFFLCSAYAPMCTDKVdv-vITSCRP 79  starlet sea ane...
Feature 1                                                        
Q9ULV1       120 MCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEV 167 human
Q9PT62       106 MCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDDEV 153 African clawed frog
Q9IA05       108 MCLSVKRRCEPVLKEFGFAWPDSLNCSKFPPQNDHNHMCMEGPGDEEV 155 chicken
Q9NBW1       122 LCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCMEGPGELHQ 169 fruit fly
Q10662       101 LCLSVQEKCLPVLESFGFKWPDVIRCDKFPLENNREKMCMKGPNEQGA 148 Caenorhabditis elegans
CAF96654     109 MCISVKKRCFPVLQEFGFIWPEELNCSLFPPQNDHNHMCMEGPGDEDL 156 spotted green pufferfish
EEC00899     116 LCESVRTRCQPVLQEFGFPWPAALNCSKFPPQNNHRHMCMDGPAPEES 163 black-legged tick
XP_002237646 111 MCLSVKRRCEPVLKEFGFPWPPTLNCSKFPLQNDHNTMCMEGPGDDEV 158 Florida lancelet
NP_001071724 131 MCLSIKKLCLPALKSFGYPWPEILNCSNFPKDNKQNMMCMTGTHPHVK 178 Ciona intestinalis
XP_788346    108 LCERVRASCNPVLSKFGFKWAEALNCSQFLERSDGNDICMGPPPGEGD 155 purple urchin
XP_001622965  80 LCEYVRKSCLPVLTEFGIPWPNPLNCTRFLVRNNERNMCMPGPNFTES 127 starlet sea anemone

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap