Conserved Protein Domain Family
CRD_corin_1

?
cd07445: CRD_corin_1 
One of two cysteine-rich domains of the corin protein, a type II transmembrane serine protease .
The cysteine-rich domain (CRD) is an essential component of corin, a type II transmembrane serine protease which functions as the convertase of the pro-atrial natriuretic peptide (pro-ANP) in the heart. Corin contains two CRDs in its extracellular region, which play an important role in recognition of the physiological substrate, pro-ANP. This model characterizes the first (N-terminal) CRD.
Statistics
?
PSSM-Id: 143554
View PSSM: cd07445
Aligned: 4 rows
Threshold Bit Score: 204.396
Threshold Setting Gi: 169145903
Created: 23-Jan-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                    # ##  ###                                                            
Q9Y5Q5        135 NTSACMNITHSQCQMLPYHATLTPLlsvv-rnmEMEKFLKFFTYLHRLSCYQHIMLFGCTLAFPECIIDGDDSHGLLPCR 213  human
Q9Z319        202 NTSTCMNITHSQCQILPYHSTLAPLlpiv-knmDMEKFLKFFTYLHRLSCYQHILLFGCSLAFPECVVDGDDRHGLLPCR 280  house mouse
CAQ13859        5 TESQCNMLPYNQSGVMVGRSVVKSS--------ELQMFLKFFSYLSRLSCYRHIMLFGCSIALPQCISHRDGRTLVLPCQ 76   zebrafish
XP_002194212  367 GVGACRNITNSQCQMLPYNYTTVTSvlsivksiEMEKFLKFFSYLNRLNCYQHIMLFGCSLALPECISDGDDSLGLLPCR 446  zebra finch
Feature 1                                                            
Q9Y5Q5        214 SFCEAAKEGCESVLGMVNYSWPDFLRCSQFRNQTESSNVSR-ICFSPQQEN 263  human
Q9Z319        281 SFCEAAKEGCESVLGMVNSSWPDSLRCSQFRDHTETNSSVRkSCFSLQQEH 331  house mouse
CAQ13859       77 SFCEAAREGCEPVLQMFNASWPEFLRCSQFSNNSGTAVENTaLCYTPKHAR 127  zebrafish
XP_002194212  447 TFCEAAKEGCEPVLGMVNASWPDFLKCSQFQNKTENDTTTR-VCFSPHQEK 496  zebra finch

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap