Conserved Protein Domain Family
CRD_SFRP5

?
cd07444: CRD_SFRP5 
Cysteine-rich domain of the secreted frizzled-related protein 5 (SFRP5), a regulator of Wnt activity.
The cysteine-rich domain (CRD) is an essential part of the secreted frizzled-related Protein 5 (SFRP5), which regulates the activity of Wnt proteins, key players in a number of fundamental cellular processes such as embryogenesis and postnatal development. SFRPs antagonize the activation of Wnt signaling by binding to the CRD domains of frizzled (Fz) proteins, thereby preventing Wnt proteins from binding to these receptors. SFRPs are also known to have functions unrelated to Wnt, as enhancers of procollagen cleavage by the TLD proteinases. SFRPs and Fz proteins both contain CRD domains, but SFRPs lack the seven-pass transmembrane domain which is an integral part of Fzs.
Statistics
?
PSSM-Id: 143553
View PSSM: cd07444
Aligned: 5 rows
Threshold Bit Score: 266.812
Threshold Setting Gi: 61216860
Created: 23-Jan-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                       # ### ###                                                        
Q9WU66        44 YSKPPQCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRS 123 house mouse
Q5T4F7        47 YSKPPQCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRS 126 human
XP_421707     44 YGREPQCVDIPADMQLCHDVGYKRMRLPNLLEHESMAEAKQQASSWVPLLAKQCHADTQLFLCSLFAPVCLDRPIYPCRS 123 chicken
NP_001083946  43 YTKQSQCIDIPSDLHLCHNVGYKKMRLPNLLDHETMPEVKQQASSWVPLLAKRCHRDTQLFLCSLFAPICLERPIYPCRS 122 African clawed ...
NP_571933     46 YAKQPQCVDIPADLRLCYNVGYKKMRLPNLLDHETMPEVKQQAGSWVPLLAKRCHADTQVFLCSLFAPVCLDRPIYPCRS 125 zebrafish
Feature 1                                                       
Q9WU66       124 LCEAARAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPAT 170 house mouse
Q5T4F7       127 LCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPAT 173 human
XP_421707    124 LCEVVRDACAPVMESYGFPWPEMLHCGKFPSDHDLCIAVQFGNNQAT 170 chicken
NP_001083946 123 LCEVVRDSCAPVMESYGFPWPEMLNCNKFPLDNDLCITVQFGSKQVT 169 African clawed frog
NP_571933    126 LCEAVRDSCAPVMETYGFPWPEMLQCEKFPIDNDLCIPMQFSAGHAT 172 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap