Conserved Protein Domain Family
CRD_SFRP1

?
cd07443: CRD_SFRP1 
Cysteine-rich domain of the secreted frizzled-related protein 1 (SFRP1), a regulator of Wnt activity.
The cysteine-rich domain (CRD) is an essential part of the secreted frizzled-related protein 1 (SFRP1), which regulates the activity of Wnt proteins, key players in a number of fundamental cellular processes such as embryogenesis and postnatal development. SFRPs antagonize the activation of Wnt signaling by binding to the CRDs domains of frizzled (Fz) proteins, thereby preventing Wnt proteins from binding to these receptors. SFRPs are also known to have functions unrelated to Wnt, as enhancers of procollagen cleavage by the TLD proteinases. SFRPs and Fz proteins both contain CRD domains, but SFRPs lack the seven-pass transmembrane domain which is an integral part of Fzs. SFRP1 is expressed in many tissues and is involved in the regulation of Wnt signaling in osteoblasts, leading to enhanced trabecular bone formation in adults; it has also been shown to control the growth of retinal ganglion cell axons and the elongation of the antero-posterior axis.
Statistics
?
PSSM-Id: 143552
View PSSM: cd07443
Aligned: 5 rows
Threshold Bit Score: 250.201
Threshold Setting Gi: 76779937
Created: 23-Jan-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                    # ### ###                                                        
O19116     46 YTKPPQCVDIPADLRLCHNVGYKRMVLPNLLEHETMAEVKQQASSWVPLLNKNCHIGTQVFLCSLFAPVCLDRPIYPCRW 125 cattle
Q9DEQ4     52 YTKPHQCVAIPADLRLCHSVGYDKMVLPNLLDHETMAEVKHQASSWVPLLNKNCHMGTQVFLCSLFAPVCLDRPVYPCRW 131 chicken
Q8N474     52 YTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRW 131 human
AAI54249   36 SDKHPPCVDIPEDLRLCFNVGYGRMMLPNLLDHETIAEVKQQAVSWVPLVHKACHKGTQVLLCSLFAPVCLDRPLYPCRW 115 zebrafish
AAI06361   48 YSRPAQCLEIPQDMTLCHGVGYNKMVLPNLLDHETMAEVKYQASSWVPLLSKKCHPSTQVFLCSLFAPVCLDRPVYPCRR 127 African clawed frog
Feature 1                                                  
O19116    126 LCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDV-CIAMTPPNAT 169 cattle
Q9DEQ4    132 LCEAVRDSCEPVMQFFGFFWPEMLKCDQFPQDYV-CIAMTTPNAT 175 chicken
Q8N474    132 LCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDV-CIAMTPPNAT 175 human
AAI54249  116 FCEAVRDSCAPIMQAFGFPWPEMLRCDKFPLGEV-CISSNATKSN 159 zebrafish
AAI06361  128 LCESVRDACEPVMQYFGFHWPEMLRCEQYPTEEDvCIAVHLPNAT 172 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap