Conserved Protein Domain Family
CRD_SFRP4

?
cd07442: CRD_SFRP4 
Cysteine-rich domain of the secreted frizzled-related protein 4 (SFRP4), a Wnt antagonist.
The cysteine-rich domain (CRD) is an essential part of the secreted frizzled-related Protein 4 (SFRP4), which regulates the activity of Wnt proteins, key players in a number of fundamental cellular processes such as embryogenesis and postnatal development. SFRPs antagonize the activation of Wnt signaling by binding to the CRDs domains of frizzled (Fz) proteins, thereby preventing Wnt proteins from binding to these receptors. SFRPs are also known to have functions unrelated to Wnt, as enhancers of procollagen cleavage by the TLD proteinases. SFRPs and Fz proteins both contain CRD domains, but SFRPs lack the seven-pass transmembrane domain which is an integral part of Fzs.
Statistics
?
PSSM-Id: 143551
View PSSM: cd07442
Aligned: 3 rows
Threshold Bit Score: 277.293
Threshold Setting Gi: 61216780
Created: 23-Jan-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   # ### ###                                                            
Q6FHJ7        20 RGAPCEAVRIPMCRHMPWNITRMPNHlHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLEflhdPIKPCKS 99  human
XP_418831     50 QGAPCEAVRIPMCRPMPWNITRMPNHlHHSTQENAVLAIEQYEELVGTGCSPVLPFFLCAMYAPICTLEflydPIKPCRS 129 chicken
XP_002197350  19 QGAPCEAVRIPMCRSMPWNITRMPNHlHHSTQENAVLAIEQYEELVATGCSPVLPFFLCAMYAPICTLEflydPIKPCRS 98  Taeniopygia gut...
Feature 1                                                       
Q6FHJ7       100 VCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDL 146 human
XP_418831    130 VCQRARDGCEPIMRRYNHSWPDSLACDDLPVYDRGVCISPEAIVTDL 176 chicken
XP_002197350  99 VCQRARDGCEPIMRRYNHSWPESLACYDLPVYDRGVCISPKAITKPT 145 Taeniopygia guttata

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap