Conserved Protein Domain Family
MPP_Rhilphs

?
cd07421: MPP_Rhilphs 
Rhilph phosphatases, metallophosphatase domain
Rhilphs (Rhizobiales/ Rhodobacterales/ Rhodospirillaceae-like phosphatases) are a phylogenetically distinct group of PPP (phosphoprotein phosphatases), found only in land plants. They are named for their close relationship to to PPP phosphatases from alpha-Proteobacteria, including Rhizobiales, Rhodobacterales and Rhodospirillaceae. The PPP (phosphoprotein phosphatase) family, to which the Rhilphs belong, is one of two known protein phosphatase families specific for serine and threonine. The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.
Statistics
?
PSSM-Id: 163664
View PSSM: cd07421
Aligned: 5 rows
Threshold Bit Score: 593.711
Threshold Setting Gi: 168034590
Created: 4-Dec-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
active sitemetal binding
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                # #                               #   #                            ##   
AAM67172       5 PRTVICVGDIHGYISKLNNLWLNLQSAIDPSDFSSALVIFLGDYCDRGPETRKVIDFLISLPEKHPDQTHVFLAGNHDFA 84  thale cress
AAY97872      11 PRVVCCIGDIHGYITKLQNLWSNLESCVNPSDFETALIIFLGDYCDRGPETSKVVDFLISLPSKYPKQSHVFLCGNHDFA 90  Solanum lycoper...
CAE04900      35 PRVVICVGDVHGYISKLESLWANLQSALPPDAFATALVVFLGDYCDRGPSTREVIDFLLALPSRHPAQRHAFLCGNHDLA 114 Japanese rice
AAF04427       5 PRTVICVGDIHGNISKLNKLWLNLQSDIQNSDFSSALVIFLGDYCDRGPETRKVIDFLISLPEKHPDQTHVFLAGNHDFA 84  thale cress
XP_001769795   5 KRMTICVGDIHGHLDRLKALWRNLELKLGSEVFASSTVIFLGDYNDRGPDTKGVLEFLVGLPERYPKQRHVFLCGNHDFA 84  Physcomitrella ...
Feature 1                                                                                        
AAM67172      85 FSGFLGLLPRPSDGSDLKDTWKEYSKSEETEGWYTGERFEDMHLQGRRWAGKIKATFns-vkGMAYKGSIYDAGSTFESY 163 thale cress
AAY97872      91 FGAFLGVLPSPPDGSEFCETWKEYEMNEEREGWYKGESFENMHLQGRRWAGNHTVKFna-vrGIDYKGSIYDAAPTFQSY 169 Solanum lycoper...
CAE04900     115 FAAFVGALPPPPDGTPFSSTWGEYIQNEENEGWYRGPGHEGMHCQGRRWGGIMKEKRnp-krGSSYMGSIYDARPTFESY 193 Japanese rice
AAF04427      85 FAGFLGLLPRPSDGSEFKETWKEYSKSEEREGWYKGEGFENMHLQSRRWAGKIRVQFdysayGVLYNGSIYDAASTFESY 164 thale cress
XP_001769795  85 FAAFLGVLPTSSPGVEYTSTWGEYEHHEEREGWWSGPGQKEIHLQGRRWAGKMKSTWnt-trNEPYKGSIYDARPTFESY 163 Physcomitrella ...
Feature 1                                                          #              #              
AAM67172     164 GVPHGSS-DLMKAVPESHKKFLTNMVWVHEEDDVCIETEEGLKHCKLIAVHAGLEkGNNVEEQLKLLRAKDTSISKIQHL 242 thale cress
AAY97872     170 GVPHGSA-DLMKAVPDEHKKFLANLVWIHEEDDVTIKTEKGIKRCKLIAVHAGLEkNKSVEQQINTLKAKDTRIPKVAAL 248 Solanum lycoper...
CAE04900     194 GVAHGSP-DLVKAVPEEHKKFLRELVWIHEEENVPIDTNEGQIICKLIAVHAGLErSIDLNEQFRILRTKDTKISKVAML 272 Japanese rice
AAF04427     165 GVPHGSS-DLIKAVPESHKKFLTNMVWVHKEDDVCIETEEGLTHCKLIAVHAGLEtKNNVEEQLKLLRDKDTSIPRIQPL 243 thale cress
XP_001769795 164 GVSHGDRaGLIAAVPDNHKEFLRNLAWVHEQVRLAFLTDPETSYTKLIAVHGGLE-SNSLDNQMQMLRTKNGMLPRIEPL 242 Physcomitrella ...
Feature 1                                                        #                               
AAM67172     243 SGRKNVWDIPq-------------------------eLDDKHTVVVSGHHGKLHIDGMRLIIDEGGGFPDKPVAAIVLPS 297 thale cress
AAY97872     249 SGRKDVWEIPq-------------------------eLTKTPTIIVSGHHAKLHIEGLRLVIDQGGGFEDQPVAAIVLPS 303 Solanum lycoper...
CAE04900     273 SGRQDVWNIPkliyklqlrrllyrnrrkvgnatkikdLAGKQTIVVSGHHGKLHIDGLRFVIDEGGGYADRPIAAIVFPS 352 Japanese rice
AAF04427     244 TGRKTVWGIPq-------------------------eLDDKKTIVVSGHHGKLHIDGLRLIIDEGGGYTDTPLAAIVLPS 298 thale cress
XP_001769795 243 AGRKNVWNTPp-------------------------eLAAQKVLLVSGHHGKLHFESNRLIIDESGGFDDRPIAAMILPA 297 Physcomitrella ...
Feature 1                   
AAM67172     298 KKIIRDTDNLS 308 thale cress
AAY97872     304 LEIVRDTDHSV 314 Solanum lycopersicum
CAE04900     353 KELIRSTEGTS 363 Japanese rice
AAF04427     299 KKIIRDTDNFS 309 thale cress
XP_001769795 298 REIVRDTDNFS 308 Physcomitrella patens subsp. patens

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap