Conserved Protein Domain Family
2A5CPDO_A

?
cd07373: 2A5CPDO_A 
The alpha subunit of the Class III extradiol dioxygenase, 2-amino-5-chlorophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol.
2-amino-5-chlorophenol 1,6-dioxygenase (2A5CPDO) catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol, which is an intermediate during p-chloronitrobenzene degradation. This enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. The active enzyme is probably a heterotetramer, composed of two alpha and two beta subunits. The alpha and beta subunits share significant sequence similarity and may have evolved by gene duplication. This model describes the alpha subunit, which does not contain a potential metal binding site and may not possess catalytic activity.
Statistics
?
PSSM-Id: 153385
View PSSM: cd07373
Aligned: 4 rows
Threshold Bit Score: 536.406
Threshold Setting Gi: 83701633
Created: 15-Apr-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
YP_785084      1 MTIVSAFLVPGSPLPQLRPDVAPWGRFRDALRQVGRSLARSRPDCVLVYSTQWFAVLDQLWITRARSTGLHVDENWHEFG 80  Bordetella aviu...
AAK26520       1 MTIVSAFLVPGSPLPQLRADVSGWHNFQQAMRQAGAALKESRPDVVLIYSTQWFAVLDEIWLTRRHSEDIHVDENWHEFG 80  Pseudomonas putida
YP_001967697   1 MTVVSAFLVPGTPLPQLKPEVPSWGQLAAATERAGKALAASRPDVVLVYSTQWLAVLDQQWLTRPRSEGVHVDENWYEFG 80  Comamonas sp. C...
ABC41268       1 MTVVSAFLVPGTPLPQLKPEVPSWGQLAAATERAGKALAASRPDVVLVYSTQWLAVLDQQWLTRPRSEGVHVDENWYEFG 80  Pseudomonas putida
YP_785084     81 EQPFDIYSDAQLAHRCVQACNEAGIKTRSVDYDQFPIDTGTITASTLMNFGTEDLPVITAANNLYHSAAQTEQLGSIAAC 160 Bordetella aviu...
AAK26520      81 ELPYSLFSDVDLANACVEACRSQGVPARGADYKAFPIDTGTIVACTAMGIGTEALPLVVASNNLYYNGEATENIGAIAAK 160 Pseudomonas putida
YP_001967697  81 DLAYDIRADTALAEACVTSSPLHGVHARGVNYDGFPIDTGTITACTLMGIGTDAFPLVVGSNNLYHSGEITEKLAALAVD 160 Comamonas sp. C...
ABC41268      81 DLAYDIRADTALAEACVTSSPPHGVHARGVNYDGFPIDTGTITACTLMGIGTDAFPLVVGSNNLYHSGEITEKLAALAVD 160 Pseudomonas putida
YP_785084    161 ALQD--KRVAVLGIGGLSNSMFREAIDVHEDHIISEGDDAWNKRLLALIEDGDLPALRASLPEYSKAARPDMGLKQLHWL 238 Bordetella aviu...
AAK26520     161 AALDqgKRVAVIGVGGLSGSVFTSQIDPLDDHIVKPEEDEWNRQILSLLESGNLPALKEQIPHYVKAARVDMGFKHFNWV 240 Pseudomonas putida
YP_001967697 161 CAKDqnKRVAVVGVGGLSGSLFREEIDPREDRIANEEDDKWNRRVLKLIEAGDVSALREAMPVYAKEARVDMGFKHLHWI 240 Comamonas sp. C...
ABC41268     161 CAKDqnKRVAVVGVGGLSGSLFREEIDPREDRIANEEDDKWNRRVLKLIEAGDVSALREAMPVYAKEARVDMGFKHLHWI 240 Pseudomonas putida
YP_785084    239 LGAMGDRYQQAVVHEYGPLYGSGGAVVEFKL 269 Bordetella avium 197N
AAK26520     241 LGAIGGEFRSAKVYHYGAIYGSGAAVVEFNL 271 Pseudomonas putida
YP_001967697 241 LGALKGKFSGANVLGYGPSYGSGAAVIEFRL 271 Comamonas sp. CNB-1
ABC41268     241 LGALKGKFSGANVLGYGPSYGSGAAVIEFRL 271 Pseudomonas putida
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap