Conserved Protein Domain Family
2A5CPDO_B

?
cd07372: 2A5CPDO_B 
The beta subunit of the Class III extradiol dioxygenase, 2-amino-5-chlorophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol.
2-amino-5-chlorophenol 1,6-dioxygenase (2A5CPDO), catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol, which is an intermediate during p-chloronitrobenzene degradation. This enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. The active 2A5CPDO enzyme is probably a heterotetramer, composed of two alpha and two beta subunits. The alpha and beta subunits share significant sequence similarity and may have evolved by gene duplication. This model describes the beta subunit, which contains a putative metal binding site with two conserved histidines; these residues are equivalent to two out of three Fe(II) binding residues present in the catalytic subunit dioxygenase LigB. The alpha subunit does not contain these potential metal binding residues. The 2A5CPDO beta subunit may be the catalytic subunit of the enzyme.
Statistics
?
PSSM-Id: 153384
View PSSM: cd07372
Aligned: 6 rows
Threshold Bit Score: 620.845
Threshold Setting Gi: 2444170
Created: 15-Apr-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative metalputative active
Feature 1:putative metal binding site [ion binding site]
Evidence:
  • Comment:based on similarity to other members of the same protein family

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1               #                                                #                    
AAK26519    4 GEIISGFLAPHPPHMLYAENPPQNEPRSNGGWEQLRWAYERARASVEALKPDVLLVHSPHWITSVGHHFIGVPELSGRSV 83  Pseudomonas putida
AAT35226    5 GEIIAGFLAPHPPHLVYGENPPQNEPRSQGGWEVLRWAYERARERLDAMKPDVLLVHSPHWITSVGHHFLGVPELSGKSV 84  Comamonas testoste...
BAB03531    4 GEIISGFIAPHPPHLVYGENPPQNEPKSTGGWEQLRWAYERARASIEELKPDVLLVHSPHWITSVGHHFIGVDHLQGRSV 83  Pseudomonas sp.
YP_785083   4 GVILAGFLAPHPPHLVYGENPPQNEPRSEGGWEPLRWAYAQARESIARLKPDVLLVHSPHWITQVGHHFLGVPRLSGRSV 83  Bordetella avium 197N
YP_559855   4 GKILSGLLAPHPPHLVYGENPPQNEPRSQGGWEPLRWAYDQVRENIEHLKPDVLIVHSPHWITQVGHHFLGVPRLTGRSV 83  Burkholderia xenov...
AAB71524    4 GEIISGFLAPHPPHMLYAENPPQNEPRSNGGWEQLRWAYERARASVEALKPDVLLVHSPHWITSVGHHFIGVPELSGRSV 83  Pseudomonas pseudo...
Feature 1                                                                                     
AAK26519   84 DPIFPNLFRFDYSMKVDVDLAEACYEEGRNVGLETKMMRNPRFRVDYGTITTLHMIRPQWDIPVVSISANNTPYYLSMEE 163 Pseudomonas putida
AAT35226   85 DPIFPNVFRYDFSLNVDVELAEACAEEGRKAGLVTKMMRNPKFRVDYGTITTLHLIRPQWDIPVVGISANNSPYYLNTKE 164 Comamonas testoste...
BAB03531   84 DPIFPNLFRFDYSINFDVELSEACCEEGRKAGLVTKMMRNPRFRPDYGTITTLHMIRPQWDIPVVSISANNTPYYLSMEE 163 Pseudomonas sp.
YP_785083  84 DPIFPNLFRYDFGMDVDVELAEACCEEAAHLGLVSKMMRNPRFRPDYGTITTLHMIRPQWDIPVVGISANNTPYYLNTKE 163 Bordetella avium 197N
YP_559855  84 DPIFPNLFRYDFGMNVDVELAEACCEEATKLGLVSKMMRNPSFRVDYGTITTLHMVRPQWDIPVVGISANNTPYYLNTKE 163 Burkholderia xenov...
AAB71524   84 DPIFPNLFRFDYSMKIDVDLAEACYEEGRNVGLETKMMRNPRFRVDYGTITTLHMIRPQWDIPVVSISANNTPYYLSMEE 163 Pseudomonas pseudo...
Feature 1                                                                                     
AAK26519  164 GLTEMDLLGKATLEAVRKSGKRAVLLASNSLSHWHFHQEPepPEDMTKEHPESLAGYQWDMRMIDLMRRGQMQEVFRLLP 243 Pseudomonas putida
AAT35226  165 GMSEMDVLGKATREAIRKTGRKAVLLASNTLSHWHFHEEPtiPEDMSKEYPATMAGYQWDIRMIELMRQGKTSEVFKLLP 244 Comamonas testoste...
BAB03531  164 GLGEMDVLGKATREAILKSGKRAVLLASNTLSHWHFHEEPvpPEDMSKEHPQTKIGYEWDMRMIELMRQGRMEEVFQLLP 243 Pseudomonas sp.
YP_785083 164 GLGEMDVLGRATREAIRKTGRRAVLLASNTLSHWHFHEEPalPEDMTKEHPERYDGYKWDVRMIDLMRQGRMKEAFALLP 243 Bordetella avium 197N
YP_559855 164 GLGEMDLLGRATREAIRKTGRRAVLLASNTLSHWHFHEEPalPEDMSKEHPERYDGYLWDVRMIELMRKGHMKEVFELLP 243 Burkholderia xenov...
AAB71524  164 GLTEMDLLGKATLEAVRKSGKRAVLLASNTLSHWHFNQEPepPEDMTKEHPESLAGYQWDMRMIDLMRRGQMQEVFRLLP 243 Pseudomonas pseudo...
Feature 1                                                           
AAK26519  244 QFIEEAFAEVKSGAFTWMHAAMQYPELAAELHGYGTVIGTGNAVMEWNLVKAGL 297 Pseudomonas putida
AAT35226  245 QFIDEAFAEVKSGAFTWMHAAMQYPELAAELFGYGTVIGTGNAVMEWDLRKAGL 298 Comamonas testosteroni
BAB03531  244 QFIEEAFAEVKSGAFTWMHAAMQYPNLPAELHGYGTVIGTGNAVVEWNLVKAGL 297 Pseudomonas sp.
YP_785083 244 QFIDEAFAEVKSGAFTWMHAAMGYPELAGRLHGYGTVIGTGNAVIEWNLQDAGL 297 Bordetella avium 197N
YP_559855 244 QFIEEAFAEIKSGAFTWMHAAMGYPELAGKLHGYGTVIGTGNAVIEWNLEDVGL 297 Burkholderia xenovorans LB400
AAB71524  244 QFIEESFAEVKSGAFTWMHAAMQYPELAAELHGYGTVIGTGNAVMEWNLVKAGL 297 Pseudomonas pseudoalcaligenes

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap