Conserved Protein Domain Family
CarBb

?
cd07367: CarBb 
CarBb is the B subunit of the Class III Extradiol ring-cleavage dioxygenase, 2-aminophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-aminophenyl-2,3-diol.
CarBb is the B subunit of 2-aminophenol 1,6-dioxygenase (CarB), which catalyzes the oxidization and subsequent ring-opening of 2-aminophenyl-2,3-diol. It is a key enzyme in the carbazole degradation pathway isolated from bacterial strains with carbazole degradation ability. The enzyme is a heterotetramer composed of two A and two B subunits. CarB belongs to the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Although the enzyme was originally isolated as a meta-cleavage enzyme for 2'-aminobiphenyl-2,3-diol involved in carbazole degradation, it has also shown high specificity for 2,3-dihydroxybiphenyl.
Statistics
?
PSSM-Id: 153379
View PSSM: cd07367
Aligned: 8 rows
Threshold Bit Score: 425.696
Threshold Setting Gi: 87239946
Created: 21-Apr-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:Fe(II) binding site [ion binding site]
Evidence:
  • Comment:based on similarity to other members of the same protein family

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   #                                        #                           
AAY56341       1 MGKIVAAGGTSHILMSPKGCEESAARVVNGIAELGRRLKEARPDVLVIITSDHMFNINLS-MQPRFVVGIADSYTPMGDM 79  Pseudomonas sp....
BAG30828       1 MAKIVSACATSHVVMSPIGCEKQASRVVQGMEELGEKIRESEPTVLIVLSSDHMCNIDLS-LQPRFVVGVADSYMSLGDM 79  carbazole-degra...
YP_717944      1 MAELVGAFATSHVLFGSPVGDDQALRVVDGMNEIGRRVRALDPDLLVVVGSDHLFNITTK-LQPPFTVGVSDTFTPFGDM 79  Sphingomonas sp...
BAE79501       1 MGAIVGGYATSHTMFPSTGVESQAAAVVAGFEEIGDRVRESGADIVVLVSSEHGPTLPPSgPQPPFVVGTGETIRTFGEM 80  Nocardioides ar...
BAC56744       1 MGKIVAAGGTSHILMSPKGCEESAARVVNGIAELGRRLKEARPDVLVIITSDHMFNINLS-MQPRFVVGIADSYTPMGDM 79  Janthinobacteri...
BAH57737       1 MAEVVGGFATSHILMSSSGVEDKAGRVTKGMAEIGRRIQALSPDVIMVVTNDHLFNFGLD-LQVPFAIGTADAYTPLGDL 79  Lysobacter sp. OC7
BAH60862       1 MAEIVVAAGTSHILMSPKGVEDASERVFDGMMKIGRAVRLARPDVIFIISNDHQFNLDLS-VRDQFLVGTDESFMPFGEM 79  carbazole-degra...
YP_003072830   1 MGKLVCAAAMSHVLGTPKDIEEQAERVFQGMREIGRAIRDSSPDVLVVISSDHLNNFNLG-DPKPLAIATAASLQPYGDM 79  Teredinibacter ...
Feature 1                                                                                        
AAY56341      80 DIPRDLVPGSREVGRAIALQADEDGf--DLCQAEEYSLDHGIMIPILFMGMK-EIPVVPVIVNI-NTDPIPSARRCVALA 155 Pseudomonas sp....
BAG30828      80 DIPKMRVRGNREIGKSIVNQADKDGf--DMCQSEEYLLDHGIMVPLTFMGLT-DYPIVPVIINI-NTEPMASTERCLSLA 155 carbazole-degra...
YP_717944     80 DIERRPFPGHRAFAQALCRRAADSF---DLAQAEELRPDHGVMVPLMFVNPEgTTPVVPLLVNT-NMDPAPSPARCAALG 155 Sphingomonas sp...
BAE79501      81 GIPKTSFSGHPDFARGFVRHAAAAGf--DLAMIERFQADHGTAIPVLKMFPKlDVPIVPVIVNSlVAEATATAARCHQLG 158 Nocardioides ar...
BAC56744      80 DIPRDPVQGSREVGRAIALQADEDGf--DLCQAEEYSLDHGIMIPILFMGMK-EIPVVPVIVNI-NTDPIPSARRCVALA 155 Janthinobacteri...
BAH57737      80 EVPQIERPGHRPFAEEFLSYAAEAGf--DLARAESLRPDHGVSVPMLFADPSnTVPLVPLYLNL-MMDPMPSPKRCWTLG 156 Lysobacter sp. OC7
BAH60862      80 DIPLENFPGQAEFAKAFVSFSQENGv--DAVALEGLRPDHGTAVPLMFSNPDhDIPVVPLLVNL-AADTAPDTRQCWEAG 156 carbazole-degra...
YP_003072830  80 GIPTELIRGHSEFAVGFADFVARSNsglTLAQVDDVRPDHGVMIPLAITDPQrSIPVVPLYINT-VYSDSPTPTECWQLG 158 Teredinibacter ...
Feature 1                                                                                   #    
AAY56341     156 ESIRQAIEKrtpDGCRVAVVGAGGLSHWLSVprHGEVSEKFDHMVMDELVRGNa-EKLVAMGNEAIIDQGGNAGVEILTW 234 Pseudomonas sp....
BAG30828     156 KTIRKSILEqvsEDSRVSIIGAGGLSHWLCVekHGDVSEEFDLMIIDLLSKANgaERIASMGNDEIIKQGGNAGIEVVTW 235 carbazole-degra...
YP_717944    156 EVVARTVAEdlpAEVRVVALATGGLSHWINLprHGEVNAAFDERVIEALASGDl-GDLSGMGVPELLDQAGNGGLEIVNW 234 Sphingomonas sp...
BAE79501     159 QVLADYAGS---RAERVAVIGCGGLSHWPGTpeMGRINEDFDREFLALLESGGg-AHAASWTTDYILENAGNGGLEIRNW 234 Nocardioides ar...
BAC56744     156 KSIRQAIEKrtpDGCRVAVVGAGGLSHWLCVprHGEVSEQFDHMVMDELARGNt-EKLVAMGNEAIIDQGGNAGVEILTW 234 Janthinobacteri...
BAH57737     157 ETFADFVERrcsTVDRVVVLAAGGLSHWVGY--EPKVNEAWDRQFLADLEAGQf-LGWAGRSKDEILEAAGNGGLEVINW 233 Lysobacter sp. OC7
BAH60862     157 KALGSFVRDirpAGERVAVIAAGGLSHWVGFd-DQGVNEAFDHKFLKDFEGGTy-EQWVGMSMQDIERQSGNGGLEIVNW 234 carbazole-degra...
YP_003072830 159 KLLQQYVSKhraAEERIAILACGGLSHWLGVpeEGHVNEDWDRNFMRQLLGEVp-CRVNTLTNKEILSQAGNGGLEVNAW 237 Teredinibacter ...
Feature 1                                           
AAY56341     235 IMAAVASEASs--GEKVFYEAMtQWFTGIGGMEFH 267 Pseudomonas sp. XLDN4-9
BAG30828     236 MMASAISESKs--GKKYFYEPMyKWFTGIGGMELN 268 carbazole-degrading bacterium CAR-SF
YP_717944    235 IMVAAMAAGRgwrGERIYYEPMpQWMTGMGGMAFR 269 Sphingomonas sp. KA1
BAE79501     235 ILVSGAVGDQp--GRSLYYEPIpQWVTGMGAFEFN 267 Nocardioides aromaticivorans
BAC56744     235 IMAAVASEASs--GNKVFYEAMtQWFTGIGGMEFH 267 Janthinobacterium sp. J3
BAH57737     234 LFMAAAVRAQk--SETIYYEAIpEWMTGMGGIEAV 266 Lysobacter sp. OC7
BAH60862     235 LMMAATVSGAk--GEAVYYEPMpEWMTGMGGVLMQ 267 carbazole-degrading bacterium OC13S
YP_003072830 238 ITLAAALPRLq--GEVVFYEAIpLWASGMAGVQFT 270 Teredinibacter turnerae T7902

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap