Conserved Protein Domain Family
MhpB_like

?
cd07365: MhpB_like 
Subunit B of the Class III Extradiol ring-cleavage dioxygenase, 2,3-dihydroxyphenylpropionate 1,2-dioxygenase (MhpB), which catalyzes the oxidization and subsequent ring-opening of 2,3-dihydroxyphenylpropionate.
2,3-dihydroxyphenylpropionate 1,2-dioxygenase (MhpB) catalyzes the oxidization and subsequent ring-opening of 2,3-dihydroxyphenylpropionate, yielding the product 2-hydroxy-6-oxo-nona-2,4-diene 1,9-dicarboxylate. It is an essential enzyme in the beta-phenylpropionic degradation pathway, in which beta-phenylpropionic is first hydrolyzed to produce 2,3-dihydroxyphenylpropionate. The enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like class III enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents the catalytic subunit, B. MhpB is likely to be a tetramer.
Statistics
?
PSSM-Id: 153377
View PSSM: cd07365
Aligned: 18 rows
Threshold Bit Score: 476.394
Threshold Setting Gi: 75421362
Created: 10-Apr-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:Fe(II) binding site [ion binding site]
Evidence:
  • Comment:based on similarity to other members of the same protein family

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                #                                          #                           
ZP_00416214   1 MTIKLKCLSHTPLRGLNDPGadvVAEVDAVLARSRAEVEAFDPELIVIFAPDHYNGLFYDLMPPFVIATAAESVADYGTL 80  Azotobacter vine...
Q7N4V6        1 MTVKLICTSHTPLMGFGSPPeatEKHVRQVFQQLAEQIKDYDPQLIVIFAPDHFNGFFYDLMPAFCVGVRANAVGDWDIG 80  Photorhabdus lum...
P0ABR9        1 MHAYLHCLSHSPLVGYVDPAqevLDEVNGVIASARERIAAFSPELVVLFAPDHYNGFFYDVMPPFCLGVGATAIGDFGSA 80  Escherichia coli...
A1K6Y7        1 MSAMLQCMSHTPLKGYFDPAadvVEEVAALAAAVREEVAHFDPEVVYLFAPDHYNGFFLDLMPQFCLGIEATSVGDYQTP 80  Azoarcus sp. BH72
Q9KH19        1 MPVALCAMSHSPLMGRNDPEqevIDAVDAAFDHARRFVADFAPDLIVIFAPDHYNGVFYDLLPPFCIGAAAQSVGDYGTE 80  Rhodococcus sp.
Q47GC9        1 MAALLQCISHSPMKGYVDPSpaiVSDVEVAIARMRKELVDFDPEVIFLFAPDHYNGFFLDVMPQFCVGIAATSVGDYRTT 80  Dechloromonas ar...
O69791        1 MTLALVCTSHSPLLEFNNPPpevRTEVDRAFAQARQFIEEYDPDLVVSFAPDHYNGFFYKLMPSFCIGFEASGVGDFGSS 80  Rhodococcus
ACJ12460      7 TTAALVGLSHSPLIGKNDPApdvLARINAAVEGARAFVRDFDPELVVLYAPDHYNGFFYKEMPPFCLATEAHAVGDFGSQ 86  Rhodococcus sp. ...
Q8L3D8        1 MSLSLVAMSHTPLLHRVEVDpqvRAEVDGAFEAVRAFVAEVDPELVITIGPDHYNGFFYDTMPPFCLGLGAYGLGDYGTA 80  Terrabacter sp. ...
O05146        1 MKQALLCMSHSPLLHHLDPPadvKASVEAAFDQARAFVHNFDPDVIVNFGPDHYNGFFYDLMPPFCIGYKAKGSGDYDSF 80  Rhodococcus glob...
Feature 1                                                                                       
ZP_00416214  81 PGPLSIPRDLALDLTRHILDSGLDIALSHRLQVDHGCTQTLEELTGSLTRYPVIPIIINSVAPPFAPYRRIRKLGEAVGR 160 Azotobacter vine...
Q7N4V6       81 KGPLNVPENTAKDLISALYDSGIDVAHSWRMQVDHGFTQPLMLLCQNLQRYPTIPIFINCAAKPLPTCRRAVELGRAVGQ 160 Photorhabdus lum...
P0ABR9       81 AGELPVPVELAEACAHAVMKSGIDLAVSYCMQVDHGFAQPLEFLLGGLDKVPVLPVFINGVATPLPGFQRTRMLGEAIGR 160 Escherichia coli...
A1K6Y7       81 KGPLRVPRALAEACAGAVIARGIDLAFSYRMQVDHGFAQTLVEVLGGLARYPVVPIMINAVAPPLASFQRARLLGAAVGE 160 Azoarcus sp. BH72
Q9KH19       81 AGPLDVDRDAAYAVARDVLDSGIDVAFSERMHVDHGFAQALQLLVGSITAVPTVPIFINSVAEPLGPVSRVRLLGEAVGR 160 Rhodococcus sp.
Q47GC9       81 PGPINVPREIARSCAEHLISNDIDVAISYRMQVDHGMVQPLEELMGGLNAYPVVPLFVNGVAPPLISIRRARLFGAAVGE 160 Dechloromonas ar...
O69791       81 AGRLDVPSALAEQMAQSVLDQGVDIAVSLEMEVDHGAVQPLEILLGGIATKPVIPIFVNSVAAPFAPMKRIRLLGEAVGT 160 Rhodococcus
ACJ12460     87 AGPLSVEATVARALTQGVLDRGIDLTVSARMIVDHGFAQPLEVLFGGIDRVPVVPIFVNGVATPLGPVSRIRALGNAVGE 166 Rhodococcus sp. ...
Q8L3D8       81 SGALDVPADIAEDLARHVQGEDIDLTISRAMGVDHGAVQPLEVIFGQIDTVPTIPVFVNGVAAPFVPMRRIRALGESIGR 160 Terrabacter sp. ...
O05146       81 AGELNVPEAMAEDLAQFVMDQGLDIAISRQMEVDHGAVQPMEIIYGDVASKPLIPVFVNSVARPFVKVARVRKFGEAVGA 160 Rhodococcus glob...
Feature 1                                                                                       
ZP_00416214 161 FVASLGKRVLILGTGGLSHEPPVPllsga-aeeiAEFLIAGRNPTPEARAar-qaRTIAAGKIYGTAESPLTPLNTDWDL 238 Azotobacter vine...
Q7N4V6      161 FLFTTDQRVLLLGSGGLSHDPPIPqmgqv-ppevEEGLIAGRNPTKEARQkr-qiRVIEVGKSLARGENIVAPLNPQWDD 238 Photorhabdus lum...
P0ABR9      161 FTSTLNKRVLFLGSGGLSHQPPVPelaka-dahmRDRLLGSGKDLPASERelrqqRVISAAEKFVEDQRTLHPLNPIWDN 239 Escherichia coli...
A1K6Y7      161 FARGQGGRALFIASGGMSHNPPIPqiatatdpevIERIVAGRNPTPEARAar-qqRTVAAAQAFAAGDSPLRPLNPDWDR 239 Azoarcus sp. BH72
Q9KH19      161 AAAKLDKRVLFVGSGGLSHDPPVPqfata-peevRERLIDGRNPSAAERDar-eqRVITAGRDFAAGTAAIQPLNPEWDR 238 Rhodococcus sp.
Q47GC9      161 YAKKLNKRCLFIGSGGLSHNPPVPqidta-teefAEFLIAGRNPSPERRAar-qqRTKDAAIRFAAGDSQLHPINSVWDE 238 Dechloromonas ar...
O69791      161 FLKNFDGNVLLLGSGGLSHDPPVPrleaa-tgeqRKMLLGCNHPTAAARAvr-qqRVIDTAKAFTRGEAGIMDLAPEWDR 238 Rhodococcus
ACJ12460    167 AVSDLDKRVLFLASGGLSHDPPVPtldga-pprvADALIEGHPPTPEQRAkg-eeRVIQTGRDYAAGSTTMIPINPTWDN 244 Rhodococcus sp. ...
Q8L3D8      161 WAAGRPERILVIASGGLSHDPPVPqrata-tpavSAALLAGRNPPPQARAar-eqRVADTAHAFAAGTATILDLNPEWDA 238 Terrabacter sp. ...
O05146      161 YFKNSDKKVLFIGSGGLSHDPPVPqiata-deaqRKMLTDGRNPTPQARAar-qqRVIDTAVKFAADEADIMDLNPEWDR 238 Rhodococcus glob...
Feature 1                                      #                                          
ZP_00416214 239 AFIDLLVQGRLAEIDdFVVEEISTTAGRSTHEIRTWVAAFAALAAgga--yraRQDYYRPINEWIAGYGVVSAE 310 Azotobacter vinelandii
Q7N4V6      239 ELLRIFCSGDIRRLAsLTEGGIAIQGGKGGQEIRCWIAAFAALSVyge--ykaQRHYYQPIKEWLAGMAMVSAQ 310 Photorhabdus luminesce...
P0ABR9      240 QFMTLLEQGRIQELDaVSNEELSAIAGKSTHEIKTWVAAFAAISAfgn--wrsEGRYYRPIPEWIAGFGSLSAR 311 Escherichia coli K12
A1K6Y7      240 ALMKRLCSRDWAAIDaYRNDEVSAAAGASAHELKSWVAATAAMESatagqwdaRERYYRAIPEWLAGFGAMSGL 313 Azoarcus sp. BH72
Q9KH19      239 HLLDVLASGDLEQIDaWTNDWFVEQAGHSSHEVRTWIAAYAAMSAagk--yrvTSTFYREIHEWIAGFGITTAV 310 Rhodococcus sp.
Q47GC9      239 AFMADLVNQDWGALDaYRNSEITEQAGISTHEAKSWVAAHAAMNAatsggymaEVRYYKAIPEWIVGYGAMAGS 312 Dechloromonas aromatic...
O69791      239 QLLDILASGELERLDaWTAKEMAATAGNSAHEVRTWVAAHNALKAaagq-ytvTSEYYRPIPEYIAGFAVTTAV 311 Rhodococcus
ACJ12460    245 LVLDTFEKGTLTDTDgWTVDWMGAEGGGSAHEVRTWIAAYASLAAgaa--ytmESRFYEPVPEWIAGFSVTTAT 316 Rhodococcus sp. T104
Q8L3D8      239 QFLRVCREGEVAAFDdYDTDEMAATAGNSSHEVRSWVTAFSALSAvgd--yavELEYYRKIREFIAGFGVMTAR 310 Terrabacter sp. DBF63
O05146      239 GFLDVCASGRIEDFDrYTADDMDAVAGHSSHEVRNWVAAYSALRAcge--yeiAYEFYRPIKEYISGFAVTTAI 310 Rhodococcus globerulus

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap