1B4U,1BOU


Conserved Protein Domain Family
PCA_45_Dioxygenase_B

?
cd07364: PCA_45_Dioxygenase_B 
Click on image for an interactive view with Cn3D
Subunit B of the Class III extradiol dioxygenase, Protocatechuate 4,5-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of protocatechuate.
Protocatechuate 4,5-dioxygenase (LigAB) catalyzes the oxidization and subsequent ring-opening of protocatechuate (or 3,4-dihydroxybenzoic acid, PCA), an intermediate in the breakdown of lignin and other compounds. Protocatechuate 4,5-dioxygenase is an aromatic ring opening dioxygenase belonging to the class III extradiol enzyme family, a group of enyzmes that cleaves aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon using a non-heme Fe(II). LigAB is composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. The B subunit (LigB) is the catalytic subunit of LigAB.
Statistics
?
PSSM-Id: 153376
View PSSM: cd07364
Aligned: 11 rows
Threshold Bit Score: 535.821
Threshold Setting Gi: 257057775
Created: 10-Apr-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 3 residues -Click on image for an interactive view with Cn3D
Feature 1:Fe(II) binding site [ion binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   #                                                #                   
1B4U_B         1 MARVTTGITSSHIPALGAAIQTGTSDNDYWGPVFKGYQPIRDWIKqpgNMPDVVILVYNDHASAFDMNIIPTFAIGCAET 80  Sphingomonas pa...
1BOU_B         1 MARVTTGITSSHIPALGAAIQTGTSDNDYWGPVFKGYQPIRDWIKqpgNMPDVVILVYNDHASAFDMNIIPTFAIGCAET 80  Sphingomonas pa...
Q8RNX9         1 MARITASVFTSHVPAIGAAMDMGKTQEAYWAPLFKGYDFSRQWMKd--NKPDVIFLVYNDHATAFSLDCIPTFAIGTAAE 78  Comamonas testo...
AAK16524     147 PAQYTSALFTSHVPAIGAAMDLGKTEEPYWKKVFSGYEWTREWAKe--NLPDVVILVYNDHATAFDSSIIPTFVLGTGAE 224 Arthrobacter ke...
ABD84013       1 MARITASVYTSHVPAIGAAMDLGKADEPYWQPLFKGFEHSRQWLKd--NKPDVIFLVYNDHATAFSLDFIPTFAIGTAAE 78  Pseudomonas sp....
ZP_01115430    1 MAKIMCGIGSSHVPAIGAAIDHGNTQTDYWKPLFDGYQPARDWIKe--NKPDVAIVVYNDHASAFSLQLIPTFTLGVAPE 78  Reinekea sp. ME...
YP_001859410   1 MARIIGGVGTSHVPSIGAAIDHGKVDDPYWRPLFEGVQPARKWIEk--MKPDVAIVVYNDHASRFALDMTPTFAIGMGER 78  Burkholderia ph...
ABL61027       1 MARLIAGMGTSHVPGVGAAMDNGKTHEDYWVELFKGFEPIRAWHAk--NVPDVNIIVFNDHATSMSLNHYSTFMMGVAEQ 78  uncultured mari...
ZP_05126311    1 MAKLIAGIGTSHVPSIGAAVDNGKTQTEYWKPLFDQFEPARSWVEt--VKPDVSIIVYNDHAHAFDLGSIPTFSIGTCES 78  gamma proteobac...
YP_003135607   1 MAEVIWGLATSHVPSIGAAMDNGKTDNEYWKPLFDGYRPAREWMAq--HRPDVAIIVYNDHANALDIDMVPTFAIGMADK 78  Saccharomonospo...
YP_003278456   1 MAEIIGGVGTSHVPAIGAAIDHGKCHEPYWQPVFSGMQAARDWIAk--TQPDVCIIVYNDHASCFDLRLTPTFALGVGEK 78  Comamonas testo...
Feature 1                                                                                        
1B4U_B        81 FKPADEGWGPRPVPDVKGHPDLAWHIAQSLILDEF-DMTIMNQMDVDHGCTVPLSMIFGEPEe----WPCKVIPFPVNVV 155 Sphingomonas pa...
1BOU_B        81 FKPADEGWGPRPVPDVKGHPDLAWHIAQSLILDEF-DMTIMNQMDVDHGCTVPLSMIFGEPEe----WPCKVIPFPVNVV 155 Sphingomonas pa...
Q8RNX9        79 FQPADEGWGPRPVPKVVGHPDLASHIAQSVIQQDF-DLTIVNKMDVDHGLTVPLSLMCGEQDpktgsWPCPVIPFAVNVV 157 Comamonas testo...
AAK16524     225 YPVADEGYGPRPVPDVKGYPELAAHIAQSVIQDDF-DLTLVNEMVVDHGLTVPLSLVYGDVEe----WPVRVIPLAVNVV 299 Arthrobacter ke...
ABD84013      79 YQPADEGWGPRPVPKVVGHPELASHIAQSVIQQDF-DLTIVNKMDVDHGLTVPLSLMCGQQDartgaWPCPVIPFAVNVV 157 Pseudomonas sp....
ZP_01115430   79 FHPADEGYGPRKVPTAQGDPDLAWHLAESLILDEF-DMTIANEMDIDHGCTVPLSIMFDQPEa----WPCKVIPLCVNVI 153 Reinekea sp. ME...
YP_001859410  79 FSPHDEGYGPRPVPVCQGDPALAWHLAESLVLKDEfDIAMVSEMTVDHGLTVPLSLLFGQPEa----WPCRIIPLCVNVI 154 Burkholderia ph...
ABL61027      79 FQPADEGWGPRKVPMVEGHPELAWHLVENLILDEF-DMAVTADFDVDHGLTVPLSIAYDQPDa----WPAKVIPLCVNVI 153 uncultured mari...
ZP_05126311   79 FRSSDEGYGPRPIPDVQGDPRLAWHLIESLVLDQF-DITMVNDMTVDHGLTVPLSIMYDQPTn----WPCKVIPLAVNVV 153 gamma proteobac...
YP_003135607  79 YRVADEGFGPRPVPDVVGDPDLSFHLLQQLVDAGF-DMTAIQNLDVDHGLTVPLSVYCPEPGd---aWPCAVVPLLVNVL 154 Saccharomonospo...
YP_003278456  79 FAPHDEGYGPRPVPEVQGVPELAWHIAESLIAQNF-DLTLVSEMSVDHGLTVPLSILYDQPSv----WPCKVIPLCVNVI 153 Comamonas testo...
Feature 1                                                                                        
1B4U_B       156 TYPPPSGKRCFALGDSIRAAVESFP-EDLNVHVWGTGGMSHQLQGPRAGLINKEFDLNFIDKLISDPEELSKMPHIQYLR 234 Sphingomonas pa...
1BOU_B       156 TYPPPSGKRCFALGDSIRAAVESFP-EDLNVHVWGTGGMSHQLQGPRAGLINKEFDLNFIDKLISDPEELSKMPHIQYLR 234 Sphingomonas pa...
Q8RNX9       158 QYPVPTGQRCFNLGRAIRKAVESYD-QDINVHIWGTGGMSHQLQGARAGLINKEWDNQFLDLLVENPHGLAQMPHIDYVR 236 Comamonas testo...
AAK16524     300 QYPVPSGRRCYELGRALRRALDKWDgEPLKVQIWGTGGMSHQLQGPRAGLINEEWDNAFLDHLIADPVGLTEWQHMEYVD 379 Arthrobacter ke...
ABD84013     158 QYPVPSGQRCFNLGRAIRRAVESFD-EDLNVQIWGTGGMSHQLQGARAGLINKEWDNRFLDLLIENPAGLAKMPHIDYVR 236 Pseudomonas sp....
ZP_01115430  154 QYPAPTGKRCFDLGKAIRKAVESYD-KDIKVAIFGTGGMSHQLQGERAGLVNAEFDQAFLKDLSENPDRLVKIPHVEYMR 232 Reinekea sp. ME...
YP_001859410 155 QYPQPTALRCLRLGQALRRAIDAYE-PDLKVAIFGTGGMSHQLQGERAGLINADYDKMWLDKMESDPQSLARISHTELLR 233 Burkholderia ph...
ABL61027     154 QYPQPTALRCFKLGQAIRRAVDSFP-EDITVGIWGTGGLSHQLGGERAGVVNPDFDKRFLDNLVSDPIANASLTHTDFIR 232 uncultured mari...
ZP_05126311  154 QYPQPTGRRCYALGQAIRKAIESYD-QDITVAIYGTGGLSHQLQGERAGVINEPFDNWFLDKLVTDPLTVAEVDHTTWLR 232 gamma proteobac...
YP_003135607 155 QYPQPTAARCYELGKALGEAIRSYE-RDVKVAVFGTGGMSHQLAGERAGLINPEFDRMFLDKIQTDPEYLAGLTREDYIR 233 Saccharomonospo...
YP_003278456 154 QHPLPTAARCHALGKALRVAIESHA-SGLKVVVIGTGGLSHQLQGERAGLINAAYDQRWLDLFIHEPERVAEIGVAEMLR 232 Comamonas testo...
Feature 1               #                                           
1B4U_B       235 ESGSEGVELVMWLIMRGALPEKVr------DLYTFYHIPASNTALGAMILQ 279 Sphingomonas paucimobilis
1BOU_B       235 ESGSEGVELVMWLIMRGALPEKVr------DLYTFYHIPASNTALGAMILQ 279 Sphingomonas paucimobilis
Q8RNX9       237 EAGSEGIELVMWLIARGAMSDVDgpaplpkVAHRFYHVPASNTAVGHLILE 287 Comamonas testosteroni
AAK16524     380 EAGSEGIELVDWLIARGAMDDQFgge-speVNHRFYHVPASNTAVGHLVLT 429 Arthrobacter keyseri
ABD84013     237 EAGSEGIELVMWLIARGAMADVDgpaplpkVNHRFYHVARVQYGRGTLILE 287 Pseudomonas sp. K82
ZP_01115430  233 EAGSEGIELVMWLIMRGAMADNAg------ETYSFYHVPASNTGAGLIVME 277 Reinekea sp. MED297
YP_001859410 234 EAGSEGLEIIMWLIMRGALDSSVr------RIHRFYHVPASNTAYGMLIME 278 Burkholderia phymatum STM815
ABL61027     233 EAGSEGIEMIMWNVMRGALDEDVr------EVYRLYHIPVSATAYGAIILE 277 uncultured marine bacterium HF10_25F10
ZP_05126311  233 ETGSEGIEAVMWLIMRGALSEEVk------EVYRFTHCPASNTNYGMTILE 277 gamma proteobacterium NOR5-3
YP_003135607 234 DAGSEGFELVMWLTMRGALNEQIt------RIHDVYHVPASNTAAALALFD 278 Saccharomonospora viridis DSM 43017
YP_003278456 233 ETGSEGVEAIMWMVMRGCLDARAr------TLHRFYHVPVSNTAYGLVVLE 277 Comamonas testosteroni CNB-2

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap