1YJE,2QW4


Conserved Protein Domain Family
NR_LBD_NGFI-B

?
cd07348: NR_LBD_NGFI-B 
Click on image for an interactive view with Cn3D
The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors
The ligand binding domain of Nerve growth factor-induced-B (NGFI-B): NGFI-B is a member of the nuclear#steroid receptor superfamily. NGFI-B is classified as an orphan receptor because no ligand has yet been identified. NGFI-B is an early immediate gene product of the embryo development that is rapidly produced in response to a variety of cellular signals including nerve growth factor. It is involved in T-cell-mediated apoptosis, as well as neuronal differentiation and function. NGFI-B regulates transcription by binding to a specific DNA target upstream of its target genes and regulating the rate of transcriptional initiation. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, NGFI-B has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 132762
View PSSM: cd07348
Aligned: 6 rows
Threshold Bit Score: 473.161
Threshold Setting Gi: 47229201
Created: 2-Apr-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
putativeheterodimer
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:putative coactivator recognition site
Evidence:
  • Comment:putative coactivator binding site, based on structural homology to other members of the family

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                           #  #   #    #    ## ##  ##
1YJE_A     27 PTNLLTSLIRAHLDSGPNTAKLDYSKFQElvlprfgKEDAGDVQQFYDLLSGSLDVIRKWAEKIPGFiELSPGDQDLLLE 106 Norway rat
2QW4_A     36 PANLLTSLVRAHLDSGPSTAKLDYSKFQElvlphfgKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFaELSPADQDLLLE 115 human
Q6GMG3    337 PVNIIASLVTAHIDSNPASANLDYSKYQEstsglpeKEDANDIQQFYDLLTGSMDVIRKWAGSIPGFsAFCKEDQELLLE 416 zebrafish
Q04913    340 PVDLINSLVRAHIDSIPSSSKLDYSKFQEtvplqleKESSVDVQQFYDLLSGSLEVIRKWAEKIQGFvDLPKEDQDLLLE 419 African clawed frog
CAF96539  352 SVNIVASLVRAHLDSNPTNEKLNYSKYQEsagdlkeKEDASDIQQFYDLLTGSLEVIRNWAETIPGFtDFCKDDQELLLE 431 spotted green puff...
CAG03953  250 AVSMMASLVRAHIDSNPSMLDYSKYVETEvrs--hqKEEASDIKQFYDLLAASMEAIREWAKNVPGFsDFCSEDQELLLE 327 spotted green puff...
Feature 1                                                                                     
1YJE_A    107 SAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDNILAFSRSLHSLGVDVPAFACLSALVLITDRHGLQD 186 Norway rat
2QW4_A    116 SAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQE 195 human
Q6GMG3    417 SAFVELFILRLAYRSNPETDKLIFCNGVVLHRTQCVRSFGDWIDSIMEFSQSLHRLNLDISAFSCLATLVIITDRHGLKE 496 zebrafish
Q04913    420 SAFLELFILRLAYRSRPEEGKLIFCNGVVLHRTQCVRGFGEWIDSIIEFSHSLQRMNIDVPSFSCLSALVIVTDRHGLKE 499 African clawed frog
CAF96539  432 SAFVELFILRLAYRSNPEKNKLVFCNGVVLHRLQCIHSFGDWINSIMDFSQSLHRMNLDVSLFACLAALVIITDRHGLKE 511 spotted green puff...
CAG03953  328 SAFVELFILRLAYRSDPETEKLVFCKGTVLHKTQCVRGFGDWIDSILEFSQALRRMKLDVSSFSCLAALVIITDRHGLKE 407 spotted green puff...
Feature 1                                                                         #  #   #    
1YJE_A    187 PRRVEELQNRIASCLKEHMaavagd--pqpascLSRLLGKLPELRTLCTQGLQRIFCLKLEDLVPPPPIVDKIFMDTLSF 264 Norway rat
2QW4_A    196 PRRVEELQNRIASCLKEHVaavage--pqpascLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF 273 human
Q6GMG3    497 PKRIEDFQNRLITCLRDHVstsale--vgrpnsLSRLLSKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVDKIFMDTLPF 574 zebrafish
Q04913    500 PKKVEELQSQIINCLKEHIpssmne--qnrpncLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVDKIFMDTLPF 577 African clawed frog
CAF96539  512 PKRVEEFQNHLISCLWEHVsgsgsevcrtqssyLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVEKIFLDTLPF 591 spotted green puff...
CAG03953  408 PGRVENMQNQLVTCLKDHVsgcase--ssrpnyLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVDKIFMDTLPF 485 spotted green puff...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap