Conserved Protein Domain Family
PX_SNX21

?
cd07301: PX_SNX21 
The phosphoinositide binding Phox Homology domain of Sorting Nexin 21
The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. Some SNXs are localized in early endosome structures such as clathrin-coated pits, while others are located in late structures of the endocytic pathway. SNX21, also called SNX-L, is distinctly and highly-expressed in fetal liver and may be involved in protein sorting and degradation during embryonic liver development.
Statistics
?
PSSM-Id: 132834
View PSSM: cd07301
Aligned: 4 rows
Threshold Bit Score: 214.283
Threshold Setting Gi: 113931204
Created: 14-Jan-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
phosphoinosit..
Feature 1:phosphoinositide binding site [chemical binding site]
Evidence:
  • Comment:A majority of PX domain containing proteins binds phosphatidylinositol-3-phosphate (PI3P) at this site. In some cases, other phosphoinositides, such as PI4P or PI(3,4)P2, are the preferred substrates.
  • Comment:based on the structures of phosphatidylinositol-3-phosphate bound to other members of this superfamily
  • Comment:Two basic residues are key in binding with phosphoinositides: one forms hydrogen bonds with the 3-phosphate of PI(3)P and another forms hydrogen bonds with the 4-and 5-hydroxyl groups of PI(3)P.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                ###                       ##            
JC7910       121 LLFEVTSANVVKDPpSKYVLYTLAVIGPGppDCQPAQISRRYSDFERLHRNLQRQFRGPMAAISFPRKRLRRNFTAETIA 200 human
XP_417474    139 LLFEVTSASVVSERsSKYVLYTIYLIRSGqlDRAPAAISRRYSDFERLNRRLRGRFGCDMAGIAFPRKRLRRNFTAETIA 218 chicken
NP_001070836 124 LIFEVTDASVVHETnSKYVLYTIHVIHAGtfDKTPAVITRRYTDFERLHSRLRRHYGGNIDGVYFPRKKLRKNFAAETIA 203 zebrafish
NP_001039048 107 LTFEVTDANIVQDAhAKYVLYTIYLLQTGqyDPSPAYISCRYSDLYHLKRRLLALFPSEMRGVSFPCKRVRKNFTPETIA 186 western clawed ...
Feature 1         #                              
JC7910       201 RRSRAFEQFLGHLQAVPELRHAPDLQDFFVLP 232 human
XP_417474    219 KRSRAFEQFLSHLHSIAEIRRSPEFLEFFFLQ 250 chicken
NP_001070836 204 KRSRAFEQYLTHLHSLPDLRTTPTFLEFFYLG 235 zebrafish
NP_001039048 187 KRSRAFEQFLCHVASLPALRASSAFLNFFYLR 218 western clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap