Conserved Protein Domain Family
PX_SNX20

?
cd07300: PX_SNX20 
The phosphoinositide binding Phox Homology domain of Sorting Nexin 20
The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. Some SNXs are localized in early endosome structures such as clathrin-coated pits, while others are located in late structures of the endocytic pathway. SNX20 interacts with P-Selectin glycoprotein ligand-1 (PSGL-1), a surface-expressed mucin that acts as a ligand for the selectin family of adhesion proteins. The PX domain of SNX20 binds PIs and targets the SNX20/PSGL-1 complex to endosomes. SNX20 may function in the sorting and cycling of PSGL-1 into endosomes.
Statistics
?
PSSM-Id: 132833
View PSSM: cd07300
Aligned: 3 rows
Threshold Bit Score: 204.28
Threshold Setting Gi: 189537710
Created: 14-Jan-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
phosphoinosit..
Feature 1:phosphoinositide binding site [chemical binding site]
Evidence:
  • Comment:A majority of PX domain containing proteins binds phosphatidylinositol-3-phosphate (PI3P) at this site. In some cases, other phosphoinositides, such as PI4P or PI(3,4)P2, are the preferred substrates.
  • Comment:based on the structures of phosphatidylinositol-3-phosphate bound to other members of this superfamily
  • Comment:Two basic residues are key in binding with phosphoinositides: one forms hydrogen bonds with the 3-phosphate of PI(3)P and another forms hydrogen bonds with the 4-and 5-hydroxyl groups of PI(3)P.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                ###                       ##            
NP_878274     76 LLFEIASARIEERKVSKFVVYQIIVIQTGSFDNNKAVLERRYSDFAKLQKALLKTFREEIEDVEFPRKHLTGNFAEEMIC 155 human
XP_001922916  69 LLFDIPSARIISQTISKHVVYQVVVIRSGSYDCERVAIERRYSDFLHLHQELLSDFSEELEDVVFPKKKMTRNFSEEIIA 148 zebrafish
XP_001235020  32 LLFEIPSTRIVEHHLSKYVMYKIIILQTGSFDSNKSVIERRYSDFEKLHRNLLEDFSEEMEDVTFPKKALTGNFTDEIIS 111 chicken
Feature 1         #                                
NP_878274    156 ERRRALQEYLGLLYAIrcvrrsrEFLDFLTRPEL 189 human
XP_001922916 149 ERRVALRDYLTQLYSLrfvrksqAFQSFFTHQEL 182 zebrafish
XP_001235020 112 ERKLAFKDYLRLLYSMkfirrskKFIDFLTKPEL 145 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap