Conserved Protein Domain Family
PX_RICS

?
cd07298: PX_RICS 
The phosphoinositide binding Phox Homology domain of PX-RICS
The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions such as cell signaling, vesicular trafficking, protein sorting, and lipid modification, among others. RICS is a Rho GTPase-activating protein for cdc42 and Rac1. It is implicated in the regulation of postsynaptic signaling and neurite outgrowth. An N-terminal splicing variant of RICS containing additional PX and Src Homology 3 (SH3) domains, also called PX-RICS, is the main isoform expressed during neural development. PX-RICS is involved in neural functions including axon and dendrite extension, postnatal remodeling, and fine-tuning of neural circuits during early brain development. The PX domain is involved in targeting of proteins to PI-enriched membranes, and may also be involved in protein-protein interaction. The PX domain of PX-RICS specifically binds phosphatidylinositol 3-phosphate (PI3P), PI4P, and PI5P.
Statistics
?
PSSM-Id: 132831
View PSSM: cd07298
Aligned: 4 rows
Threshold Bit Score: 253.364
Threshold Setting Gi: 47216829
Created: 9-Feb-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative
Feature 1:putative phosphoinositide binding site [chemical binding site]
Evidence:
  • Comment:A majority of PX domain containing proteins binds phosphatidylinositol-3-phosphate (PI3P) at this site. In some cases, other phosphoinositides, such as PI4P or PI(3,4)P2, are the preferred substrates.
  • Comment:based on the structures of phosphatidylinositol-3-phosphate bound to other members of this superfamily
  • Comment:Two basic residues are key in binding with phosphoinositides: one forms hydrogen bonds with the 3-phosphate of PI(3)P and another forms hydrogen bonds with the 4-and 5-hydroxyl groups of PI(3)P.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                      ###                         ##     
Q811P8        127 NVEFGSIQLSLSEEQNEVMKNGcESKELVYLVQIACQGKsWIVKRSYEDFRVLDKHLHLCIYDRRFSQLTELPRSDVlkd 206  house mouse
XP_417865      88 NVDFGNIQLSLPEEQSEVMRNGcESKELVYLVQISCQGKsWIVKRSYEDFRVLDKHLHLCIYDRRFSQLAELPRSDVlrd 167  chicken
CAG02720      148 NVDFGTLQLSLGDEQCEATRNGyESKELVYLVHIHCQGRsWIVKRTYEDFRVLDKHLHLCIYDRRFSKLPELPRLDSltd 227  spotted green...
NP_001085694  130 NVDFGSIQLTLTEDQNEVNRNGcESKELVFLVQIACQGRsWIVKRSYEDFRVLDKHLHLCIYDRRFSQLSELPRSDSvkd 209  African clawe...
Feature 1             #                              
Q811P8        207 SPESVTQMLTAYLSRLSTIAGNKINCGPALTWMEI 241  house mouse
XP_417865     168 SPELVTHTLMAYLSRLSAIACNKINCGPALTWMEI 202  chicken
CAG02720      228 QSESVSQMLLAYLSRFSAIADNKINCGPALTWMEV 262  spotted green pufferfish
NP_001085694  210 NPELVTQMLMAYLSRLSAIAGNKINCGPALTWMEI 244  African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap