2CSK


Conserved Protein Domain Family
PX_SNX12

?
cd07294: PX_SNX12 
Click on image for an interactive view with Cn3D
The phosphoinositide binding Phox Homology domain of Sorting Nexin 12
The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. Some SNXs are localized in early endosome structures such as clathrin-coated pits, while others are located in late structures of the endocytic pathway. The specific function of SNX12 has yet to be elucidated.
Statistics
?
PSSM-Id: 132827
View PSSM: cd07294
Aligned: 4 rows
Threshold Bit Score: 258.432
Threshold Setting Gi: 147903050
Created: 23-Jan-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
phosphoinosit..
Conserved site includes 7 residues -Click on image for an interactive view with Cn3D
Feature 1:phosphoinositide binding site [chemical binding site]
Evidence:
  • Comment:based on the binding of phosphatidylinositol-3-phosphate to yeast SNX3 (Grd19p)
  • Comment:Two basic residues are key in binding with phosphoinositides: one forms hydrogen bonds with the 3-phosphate of PI(3)P and another forms hydrogen bonds with the 4-and 5-hydroxyl groups of PI(3)P.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                    # #  #                   ##         
2CSK_A         8 SNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRG 87  human
NP_001026704  27 SNFLEIDIFNPQTVGMGRARYTSYELRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRG 106 chicken
NP_001085575  27 SNFLEIDIFNPQTVGVGRNRYTVYEVRMRTNLPIFKTKDSCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRG 106 African clawed ...
AAQ91274      27 SNFLEIDVYDPQTIGVGRNRFTTYEVRMRTNLPIFKLKESVVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRG 106 zebrafish
Feature 1           #        #                                       
2CSK_A        88 DEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPG 139 human
NP_001026704 107 DEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEETIDRNYVPG 158 chicken
NP_001085575 107 DEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQDETIDRNYVPG 158 African clawed frog
AAQ91274     107 DEGIFEESFIEERRAGLEQFINRIAGHPLAQNERCLHMFLQDESIDRNYIPG 158 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap