Conserved Protein Domain Family
PX_SNX3

?
cd07293: PX_SNX3 
The phosphoinositide binding Phox Homology domain of Sorting Nexin 3
The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. SNX3 associates with early endosomes through a PX domain-mediated interaction with phosphatidylinositol-3-phosphate (PI3P). It associates with the retromer complex, a membrane coat multimeric complex required for endosomal retrieval of lysosomal hydrolase receptors to the Golgi, and functions as a cargo-specific adaptor for the retromer. SNX3 is required for the formation of multivesicular bodies, which function as transport intermediates to late endosomes. It also promotes cell surface expression of the amiloride-sensitive epithelial Na+ channel (ENaC), which is critical in sodium homeostasis and maintenance of extracellular fluid volume.
Statistics
?
PSSM-Id: 132826
View PSSM: cd07293
Aligned: 4 rows
Threshold Bit Score: 252.991
Threshold Setting Gi: 57530297
Created: 23-Jan-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
phosphoinosit..
Feature 1:phosphoinositide binding site [chemical binding site]
Evidence:
  • Comment:based on the binding of phosphatidylinositol-3-phosphate to yeast SNX3 (Grd19p)
  • Comment:Two basic residues are key in binding with phosphoinositides: one forms hydrogen bonds with the 3-phosphate of PI(3)P and another forms hydrogen bonds with the 4-and 5-hydroxyl groups of PI(3)P.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                  # #  #                   ##           
O60493        28 FLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDD 107 human
NP_001006408  28 FLEIDVGNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRRYSDFEWLRNELERESKVVVPPLPGKALLRQLPFRGDD 107 chicken
CAQ14003      28 FLEIDVTNPETVGVGRNRFTTYEIKLKTNLPIFKLKESRVRRRYSDFEWLRGELERESKVVVPPLPGKALFRQLPFRGDD 107 zebrafish
NP_001087944  28 FLEIDVRNPQTVGVGRGRFTTYEVRLKTNLPIFKLKESCVRRRYSDFEWLKSELERESKVVVPPLPGKALFRQLPFRGDE 107 African clawed ...
Feature 1         #        #                                
O60493       108 GIFDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEII 150 human
NP_001006408 108 GIFDDSFIEERKQALEQFINKVAGHPLAQNERCLHMFLQDEVI 150 chicken
CAQ14003     108 GIFDDSFIEERRQGLEQFLNKVAGHPLAQNERCLHMFLQDESV 150 zebrafish
NP_001087944 108 GIFDDSFIEERKQGLEQFLNKVAGHPLAQNERCLHMFLQDEIL 150 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap