Conserved Protein Domain Family
Pat_TGL3_like

?
cd07229: Pat_TGL3_like 
Triacylglycerol lipase 3
Triacylglycerol lipase 3 (TGL3) are responsible for all the TAG lipase activity of the lipid particle. Triacylglycerol (TAG) lipases are also necessary for the mobilization of TAG stored in lipid particles. TGL3 contains the consensus sequence motif GXSXG, which is found in lipolytic enzymes. This family includes Tgl3p from Saccharomyces cerevisiae.
Statistics
?
PSSM-Id: 132867
View PSSM: cd07229
Aligned: 19 rows
Threshold Bit Score: 414.006
Threshold Setting Gi: 146099622
Created: 18-Feb-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
active sitenucleophile
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the crystal structure of semet patatin (1OXW)
  • Comment:catalytic dyad is formed by Ser and Asp
  • Comment:oxyanion hole is formed by two Gly and one Arg

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
Q9Y7P3       104 KSVYPMLMFLRSSLLRNFGNIGNsSLYTENYSGTKILIEEYVREVnnclefly------------------------htk 159 fission yeast
XP_807283     98 GDAEVLLAVLSTGLQRSVFGITN-PNLYRYLSGTKAVIEAYNSLLvyl-------------------------------- 144 Trypanosoma cru...
XP_001243270 148 DDPRVVCNTIRTGLIRNMVNIAVpELYNKAFAGTKDLIESYAAQQvislryvmqlq-----------------tspphht 210 Coccidioides im...
EEB07401     105 KNDRAIMCTLRSGFIRNLGNLGDpSLFTRTYYGTKILIEDYVHETckclhsvr------------------------msk 160 Schizosaccharom...
XP_001544935 157 NDIWVIVHLIRSGLVRNLVNITSpQLYDCAYSGTKVLIEEYISEVglaieyiaale-----------------tvprdpk 219 Ajellomyces cap...
XP_502944    115 GDIATLISRLRSGLLRNLGSISSlQLYTRSYLGSKLLIEEYITEVidclkyikdygttggldtkgvhffpkseqrqldse 194 Yarrowia lipoly...
EDK38399     124 QDSQLIMSLLRSGLVRNFGGIAQkRLFTKAYLGTKHNIEEYIEEVleclnylnesintp------------sdrenveyi 191 Pichia guillier...
CAE84405     129 ERIKEKFSTTGPCMLRNFAGIVDkKLFTKSLMGTKLLIEHHLDKTmegle-----------------------------l 179 Nakaseomyces de...
P40308       130 DVVKEKFSTTGPCMLRNFAGIGDkKLFTKSLMGTKLLIEQYLTRIlegldi----------------------------l 181 baker's yeast
XP_001592452  98 GDILQLVNLLRSGLVRNLGNICApRLFNRAFAGTKLLIEDYITQVaqavadvtqlpttp-----------gadgndgsvk 166 Sclerotinia scl...
Feature 1                                             ## #                        #              
Q9Y7P3       160 rlsyDVKCDFFSAAR----------ISFGTTCLYFNGGTAFGLYHFGVAKTLWKRNLLPQILAGCASGALIASLLSVYRD 229 fission yeast
XP_807283    145 --iqKLARDTSVDARkrystfmdvaRVYGSTALVFHGDMMLGQFHFGAAKALWKANLLPRFFYGGKTGALVSAFLCCKRN 222 Trypanosoma cru...
XP_001243270 211 gfntQAKLDFIRGAR----------QGLGRSTLLFQGGSIFGACHIGVARALYREGLLPRVITGTATGAFVAALLCIRTD 280 Coccidioides im...
EEB07401     161 eiprIEKLEFFFAAK----------LSIGRTCLFFNGGTAYGLYHFGIAKALWERGLLPRVIAGSASGALIAALLGVYTK 230 Schizosaccharom...
XP_001544935 220 afdsQDKLRLLYDTR----------QAFGRSALILQGGAVYGTCHLGVVKALFLRGLLPRIITGTATGALVAALVAVHKD 289 Ajellomyces cap...
XP_502944    195 qltrQKKHKLFYDTR----------QSFGRTALVLQGGTIFGLTHLGTIKALTLQGLLPGIVTGFKEGAFIAALTGIYVS 264 Yarrowia lipoly...
EDK38399     192 mnskQLKLDFFHDVR----------QSFGCTALVLQGGSLFGLCHLGVVKALYFKGLLPRIIGGSAVGAAVASLVCTLTD 261 Pichia guillier...
CAE84405     180 leanAAPTSFFQRCK----------LSLGTTALILQGGSFFGLFHLGVIKALLSQNLMPNIISGSSMGACIASIFGCLTN 249 Nakaseomyces de...
P40308       182 nnqtLTPTSFFQRCK----------LSLGTTALILQGGSLFGLFHLGVIRGLLLQDLMPNIISGSSMGACVASLFGCLSN 251 baker's yeast
XP_001592452 167 gfssQAKLDLLHDTR----------QAFGRSTLVLQGGAIFGLCHLGVVKALFNRGLLPRIVTGTATGALIAALVGIHTE 236 Sclerotinia scl...
Feature 1                                                                                        
Q9Y7P3       230 EELNGLFDTFPSElwkicq-----------------------------------------qtsdySLSKVVEYGNMLDIs 268 fission yeast
XP_807283    223 LAEVFDVDEAAFStfskat----------------------------------------lglfdwRWQRLWNEGYFFNIh 262 Trypanosoma cru...
XP_001243270 281 NELERFFEGEYLDimafeeprayhsldwfr-------------------ifshedgygwfqsllrRIIRCLNEHYFRDHi 341 Coccidioides im...
EEB07401     231 EEYPRMFSEFSSNlwetck-----------------------------------------ytvgfSLSKLLRYGNMLDIs 269 Schizosaccharom...
XP_001544935 290 DDLIPVLNGEGIDeavsdrlskqkhfkgwni----------------lsllardngygrlpslirRTEEYIRESYFPDLk 353 Ajellomyces cap...
XP_502944    265 DLELLETIDSLPDtlndlyqkykerlaeenkhkdhsfsnsnsdydfdyafdfeqfantynvtfssVTDKVLRSEYPPEVk 344 Yarrowia lipoly...
EDK38399     262 EELIPILISIQDAmgdvdrlnh-----------------------------------dvderygnVIENVVKKGYSQDIl 306 Pichia guillier...
CAE84405     250 EELDHLLSGDTILdlirndlelvksc--------------------------gygdieqhvnlgkLIQNLVHHGYSQDVy 303 Nakaseomyces de...
P40308       252 EQLKQLLTDDNLLniikndvdllksc--------------------------gygnleqhlnlgtLIQNLIHHGYSQDVy 305 baker's yeast
XP_001592452 237 DELPKFLNGESIDlsafagkerglq-----------------------------gssgwwdtltrRVRRFYREGYFLDVk 287 Sclerotinia scl...
Feature 1                                                                                        
Q9Y7P3       269 MIASFVRq-rLGTITFQEAFERTGRIVNIVAPpsav------sgsPQVLNYFTAPNVLIWSAVCSSNSWAAIYr-----S 336 fission yeast
XP_807283    263 VLVNFMRe-hLGDLTFLEAYQLTGRVLNIEYTpeavgvshkraplVRLLNYLTAPSVLVYSAVAASFASMPHFf----eR 337 Trypanosoma cru...
XP_001243270 342 TLQNHVRa-aLRDITFEEAYSRTKRVLNITLAmsti------ggaPNLLNYITTPHVLIWSACLASNVSFAAEe-----E 409 Coccidioides im...
EEB07401     270 IILKTVRk-cTGNMTFQEAYDRTGRVINIVITpfaf------sgsPVVLNYLTAPDVLIWSAARTSNSWAPVFr-----S 337 Schizosaccharom...
XP_001544935 354 LLEEYVKs-tVGEMTFEEAFAKTKRCLNITIPtagr------agtPNLLNYLTAPNVLIWSAAAASNVSSATSs-----R 421 Ajellomyces cap...
XP_502944    345 MYEEFIEn-qLGDLTFEEAFNKSDRVLNIVAHshd-------ssfPTLMNYLTTPNVLIRSACRASMVTAHDEpqtkkaC 416 Yarrowia lipoly...
EDK38399     307 VFLKFVRd-tIGDLTFEEAYLKTEKVLNIVVHpsh-------ssvPSLLNYITSPNVIIWTAIYASIGTGVLSd-----N 373 Pichia guillier...
CAE84405     304 LFIQFVLkyiVKDLTFEEAYQNTGKAFNIVIHpid-------nscPNLLNYVTTPNVLIRSAIECSLGTGVISt-----D 371 Nakaseomyces de...
P40308       306 LFIRFVMkyiVKEKTFEEVYQITGKVFNIVIHptd-------kscPNLLNYVTTPNVLIKSAIECSLGSGVISe-----D 373 baker's yeast
XP_001592452 288 VLEECVRa-nVGDLTFEEAYNKTKRVLNITVAtsgk------ggvPNLLNYLTAPNVLIWSAALASNASTPSLyg---sS 357 Sclerotinia scl...
Feature 1                                                                                        
Q9Y7P3       337 SPLLAKLpdgstevct---------------------------------------------------------------- 352 fission yeast
XP_807283    338 YPLLAKDlngcv-------------------------------------------------------------------- 349 Trypanosoma cru...
XP_001243270 410 VTIWCKSetgkivpwkp--------------------------------------------------------------v 427 Coccidioides im...
EEB07401     338 SKLITKQsdgslkscal--------------------------------------------------------------e 355 Schizosaccharom...
XP_001544935 422 VTLYCKDetgaivpwpd--------------------------------------------------------------a 439 Ajellomyces cap...
XP_502944    417 AHLLVKDddnsvipydacksrrgsstdvilgpvqeevdpldstangtnssgppkleittdtwkrnnaddedhvdtlpgrv 496 Yarrowia lipoly...
EDK38399     374 VQLYVKDfnnnivpkepnipikfmkpqdv-------------------------------------sysqqyfrgfkknd 416 Pichia guillier...
CAE84405     372 TKLLCKDlgnevvsflefg----------------------------------------------------------npd 393 Nakaseomyces de...
P40308       374 TSLLCKNleneiepflnin----------------------------------------------------------knk 395 baker's yeast
XP_001592452 358 VTLKCKDpstgtiipws-------------------------------------------------------------aa 376 Sclerotinia scl...
Feature 1                  #                                                                     
Q9Y7P3       353 pknfiwpyAGLPNTGRSNPy-----aRISEIFNVNHFVITQSRPSLFPTFYDELHhhrvsgyslkmirlvglemay---- 423 fission yeast
XP_807283    350 ---vpydpPVMGCVGKRSDgkvdgleRLRQLFHIKCFIVSECSFSQLPFLRLAGRtslparvwqafsqewwhlcl----- 421 Trypanosoma cru...
XP_001243270 428 dnlnlhswHTFRCRSKESPl-----rRLPELLNVNHFIISQARPFIIPIFGEATHrpgakvlarrwkifhllytlskve- 501 Coccidioides im...
EEB07401     356 efvgsrpeRNAFFSSSAFA-------RISEIFNVNHFVITQSRPSLFPFISDELHhhsyhvywvkllrvlslslaf---- 424 Schizosaccharom...
XP_001544935 440 kgllfrswRELGYNERECPv-----sRLSELFNVNHFIIAQARPFRVPIYLPEVErpgkvvsrrgvlleqtcrvinlei- 513 Ajellomyces cap...
XP_502944    497 salptpsySMINQGKIVSPy-----aRLSELFNVNHFIVSLSRPYLAPLLAIEGRhrgyhgwrvnlirvlklefehrl-- 569 Yarrowia lipoly...
EDK38399     417 hsdmersdGSRQNSKVESPy-----tRLTELFNVNHFINSLARPYLAPLISNDLKhyhsygkvrynfkslevdtnnddea 491 Pichia guillier...
CAE84405     394 tvqfvapeQATNLDEVESPy-----tRLTELFNVNNFIVSLAKPYLAPLVSNDLKheiktskyyyykh------------ 456 Nakaseomyces de...
P40308       396 qvkfltpeNANNPSITESPy-----tRLTELFNVNNFIVSLARPYLAPLVVNDLKheiktskyyyykhypnmppinantv 470 baker's yeast
XP_001592452 377 adatfrpwTHASYTDRDSPl-----sRIAELFNVNHFIVSQARPYLVPFLQSDMHgpsrlytrggrtsltggllhlitme 451 Sclerotinia scl...
Feature 1                                                                                        
Q9Y7P3       424 -------------------------------------------------------------rfrqldilgllpprlrrff 442 fission yeast
XP_807283    422 ---------------------------------------------------------------ffvsfmpfqkylwafls 438 Trypanosoma cru...
XP_001243270 502 ----------------------------------------------------------ircrlrqldsfyclpnllrsil 523 Coccidioides im...
EEB07401     425 -------------------------------------------------------------rmrqldllgfvpsklrrfv 443 Schizosaccharom...
XP_001544935 514 -----------------------------------------------------------rhrlrqldslgllptplrrll 534 Ajellomyces cap...
XP_502944    570 -----------------------------------------------------------aqfdyigllptifrrffiddk 590 Yarrowia lipoly...
EDK38399     492 dvtfgylmdepqqsksfvidkrksfladpesytkdtsinlfknlknilglelqhrlevmnklgilsdvikrfcidekpav 571 Pichia guillier...
CAE84405     457 ----------------------------------------------------------------------ypqteesidi 466 Nakaseomyces de...
P40308       471 rktqrsssqs-------------------------------------pikagtvedlepeplmspvppssavndsaeyii 513 baker's yeast
XP_001592452 452 ----------------------------------------------------------irhrleqldslqllplsirrfl 473 Sclerotinia scl...
Feature 1                                                                                        
Q9Y7P3       443 vdDYVPSAYITLTPTFSf---sDIKHAFTKPSLSd--------------------------------------------- 474 fission yeast
XP_807283    439 ngDIDAEDVIKVFPAASf---sDFITSFQLQPFSlk-------------------------------------------- 471 Trypanosoma cru...
XP_001243270 524 ieENIPGSCIVLLPQISv---qDLTKVFNKPTRDt--------------------------------------------- 555 Coccidioides im...
EEB07401     444 lkDAVLSPHIILTPNFSf---sDIVHTFTEPSPDh--------------------------------------------- 475 Schizosaccharom...
XP_001544935 535 iyEDIEGPHMTILPELGw---mDLSKVFKPPPRAge-------------------------------------------- 567 Ajellomyces cap...
XP_502944    591 ipGIGPNAEVLIVPELAagmisDFKKAFSNHDIPe--------------------------------------------- 625 Yarrowia lipoly...
EDK38399     572 apSLAGIREVSIVPELRyl-lrDFGRVFDVHKTMe--------------------------------------------- 605 Pichia guillier...
CAE84405     467 peLNIPQLNFTEMEPLAfkfkyHLERKLKNIATMefrhrmevldnlgllfpfikrliidertprsateiaivpkikslsi 546 Nakaseomyces de...
P40308       514 peLGIPQLNFTEMEPLAfkfkyHLERKLKNIATMefrhrmevldnlgllcslikrliidektprsateiavvprmkslsl 593 baker's yeast
XP_001592452 474 vdEHIPAASVTLVPVLSa---gDFIRLLETPTKEs--------------------------------------------- 505 Sclerotinia scl...
Feature 1                                                       
Q9Y7P3       475 ----------IQYWILVGERATWQAIPLLQVRCKTEISLRHRMWKPI 511 fission yeast
XP_807283    472 ---------eFQEHVLRGERGLWPFLERIREQLAAEFALNDALMQLR 509 Trypanosoma cruzi strain CL Brener
XP_001243270 556 ----------LKHWVLKGERGVWPSMTYCDGAEGLAGELFKGGVALG 592 Coccidioides immitis RS
EEB07401     476 ----------INYWILVGERTAWQAITLLRVRCKIELAIEKAEDSLF 512 Schizosaccharomyces japonicus yFS275
XP_001544935 568 ---------eIRRWILKGERGTWPAIAAVRVRCTVEFALEKGYQVVK 605 Ajellomyces capsulatus NAm1
XP_502944    626 ---------kVRYWTTVGERATWPLVAAIWARTAIEYTLNDMYNQTK 663 Yarrowia lipolytica CLIB122
EDK38399     606 ---------nIPYWVLVGERSVWPLFPLLWVRCSIEFTLDDLYNSHR 643 Pichia guilliermondii ATCC 6260
CAE84405     547 triiegqldnIPYWIKCGEQSTWPVLSLLKTRCKVELKLNEIIKHRR 593 Nakaseomyces delphensis
P40308       594 triiegqlnnIPYWIKSGERSTWPALALIKTRCAVEFKLDDIIRARR 640 baker's yeast
XP_001592452 506 ----------LDYWILRGEKSVWPAVGALKVRCAVETELDRGYQIVR 542 Sclerotinia sclerotiorum 1980

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap