Conserved Protein Domain Family
Pat_PNPLA5-mammals

?
cd07223: Pat_PNPLA5-mammals 
Patatin-like phospholipase domain containing protein 5
PNPLA5, also known as GS2L (GS2-like), plays a role in regulation of adipocyte differentiation. PNPLA5 is expressed in brain tissue in high mRNA levels and low levels in liver tissue. There is no concrete evidence in support of the enzymatic activity of GS2L. This family includes patatin-like proteins: GS2L (GS2-like) and PNPLA5 (Patatin-like phospholipase domain-containing protein 5) reported exclusively in mammals.
Statistics
?
PSSM-Id: 132862
View PSSM: cd07223
Aligned: 4 rows
Threshold Bit Score: 844.577
Threshold Setting Gi: 73969341
Created: 12-Feb-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
active sitenucleophile
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the crystal structure of semet patatin (1OXW)
  • Comment:catalytic dyad is formed by Ser and Asp
  • Comment:oxyanion hole is formed by two Gly and one Arg

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                        ## #                            #                               
Q7Z6Z6         1 MGFLEEEGRWNLSFSGAGYLGAHHVGATECLRQRAPRLLQGARRIYGSSSGALNAVSIVCGKSVDFCCSHLLGMVGQLER 80  human
XP_538337      1 MRCYEDEGSWNLSFSGAGFLGFYHVGVTRCFRERVPRLLQGARRIYGSSSGALNAVSIIADQSLDFCCSNLLGMVKHLEQ 80  dog
NP_001123969  21 MDFLEVEGGWSLSFSGSGYLGLYHVGATECLRQRAPRLIQGARRFYGSSSGALNALSIICGKSADFTCSNLLAMVKHVER 100 Norway rat
NP_083703      1 MDFLEAEGGWNLSFSGSGYMGLYHVGVTQCLRQRAPRLIQGARRFYGSSSGALNAMAIVFGKSADFACSNLLDLVKLVER 80  house mouse
Feature 1                                                                                        
Q7Z6Z6        81 LSLSILHPAYAPIEHVKQQLQDALPPDAHVLASQRLGISLTRWPDGRNFLVTDFATCDELIQALVCTLYFPFYCGlIPPE 160 human
XP_538337     81 LSLGIFHPAFAPIEHIRQQLQESLPPNIHILASQRLGISMTRWSDGRNIIVTNFATRNEVIQALICTVYFPFYCGiIPPE 160 dog
NP_001123969 101 LSLGIFHPAYGPIEHIKKKLQDDLPDNSHIVASQRLGISLTRWPDGQNFIVTDFATRDELIQALVCTLYFPFYCGtIPPA 180 Norway rat
NP_083703     81 LSLGIFHPAYGPAEHIRKKLYENLPDNCHILASQRLGISMTRWPDGKNFIVTDFATRDEFIQALICTLYLPLYCGvIPPA 160 house mouse
Feature 1               #                                                                        
Q7Z6Z6       161 FRGERYIDGALSNNLPFADCPSTITVSPFHGTVDICPQstspnlhelnvFNFSFQISTENFFLGLICLIPPSlEVVADNC 240 human
XP_538337    161 FRGERYIDGALSNHLPFSDSPSTITVSPFHGTVDICPQstsanihelnaFNASLQISTKNFFLGFSCLISPNsEVAADNC 240 dog
NP_001123969 181 FRGERFIDGALSNNLPFSNCPTTITVSPFNGTVDICPQstssslfeltaFNASFQISTRNFFLGFKSLFPPKpEVVADYC 260 Norway rat
NP_083703    161 FRGQRFIDGALSNNLPFSDCPTTITVSPFNGTVDICPQnishslfeltaFNASFQISTRNFFRGLKSVFPPKpEVVADHC 240 house mouse
Feature 1                                                                                        
Q7Z6Z6       241 RQGYLDALRFLERRGLTKEPVLWtLVSKEPPAPADGnwdagcdqrwkgglslnWKVPHVQVKDVPNFeqLSPELEAALKK 320 human
XP_538337    241 RQGYLDALRFLERRGLTKEPVLWmLVSKEPPAPADGsqdtghnrgqegglslnWAVPNVLVKDVPNFeqLSPELEAALQK 320 dog
NP_001123969 261 RQGYLDALRFLERRGLTKEPVLWsLVSKEPPALVEGprgtdhnqgqeaglivrWDIPNVLVKDVPNFelLSPELEAALKK 340 Norway rat
NP_083703    241 RQGYLDALRFLERRGLTKEPVLWsLVSKEPPALVEGprgtghdqgqktgptvrWDIPNVLVKDVPNFelLSPELEAALRK 320 house mouse
Feature 1                                                                                        
Q7Z6Z6       321 ACTrdpsrwarfwhsgpgqvLTYLLLPCTLPFEYIYFRSRRLvvwlpdvpaDLWWMQGLLRNMALEvfsrtkaQLLGPIS 400 human
XP_538337    321 ACTrdastwarfcrsrpgraLTYLLLPCTLPFEYIYFRSKRLvawlpdmpaDVWWMQGVLQSLAAEiytrskdQLLRLVS 400 dog
NP_001123969 341 ACKrdfwaqiq--csvpgkvLTYLLLPCTLPFEYAYFRSRRLmqwlpevpdDLYWMQGLLKTTTLKvysmaksWLLSLGS 418 Norway rat
NP_083703    321 ACKrdfwtrvq--csvpgkvLAYLLLPCTLPFEYAYFRSRRLmewlpeapdDLDWMRSILKSTTLEvysmaksWLLRLGS 398 house mouse
Feature 1             
Q7Z6Z6       401 PPATR 405 human
XP_538337    401 LPVTS 405 dog
NP_001123969 419 PLVTS 423 Norway rat
NP_083703    399 PPGTR 403 house mouse

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap