Conserved Protein Domain Family
Pat_PNPLA1

?
cd07219: Pat_PNPLA1 
Patatin-like phospholipase domain containing protein 1
Members of this family share a patatin domain, initially discovered in potato tubers. Some members of PNPLA1 subfamily do not have the lipase consensus sequence Gly-X-Ser-X-Gly which is essential for hydrolase activity. This family includes PNPLA1 from Homo sapiens and Gallus gallus. Currently, there is no literature available on the physiological role, structure, or enzymatic activity of PNPLA1. It is expressed in various human tissues in low mRNA levels.
Statistics
?
PSSM-Id: 132858
View PSSM: cd07219
Aligned: 5 rows
Threshold Bit Score: 623.068
Threshold Setting Gi: 118102356
Created: 12-Feb-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
active sitenucleophile
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the crystal structure of semet patatin (1OXW)
  • Comment:catalytic dyad is formed by Ser and Asp
  • Comment:oxyanion hole is formed by two Gly and one Arg

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                           ## #                            #                            
Q8N8W4         2 EEQVFKGDPDTPHSISFSGSGFLSFYQAGAVDALRDLAPRMLETAHRFAGTSAGAVIAALAICGIEMDEYLRVLNVGVAE 81  human
XP_001494853   2 EEQVFKGDPDTPHSISFSGSGFLSFYQAGAVDALRDLAPRMLETAHRFAGTSAGAVIAALAICGIEMDEYLRVLNVGVAE 81  horse
NP_001092670   2 EEQVFKGDPDTPHSISFSGSGFLSFYQAGVVDALRDLAPRMLETAHRFAGTSAGAVVAALVICGIEMDEYLRVLNVGVAE 81  cattle
XP_425818      1 MAAEELRAPGTPFSLSFSGSGFLVLYQVGVVQSLLELAPELLKSACKVYGSSAGSLIAAAVVCGISLDDLKEVFYANARE 80  chicken
XP_001378816  97 MEQNFKGDPDTPHSISFSGSGFLCYYQIGVVDAFRDLAPRMLDTAHRVVGTSAGSVVAALTVLGISMDEYLKVLNVGVAE 176 gray short-tail...
Feature 1                                                                                        
Q8N8W4        82 VKKSFLGPLSPSCKMVQMMRQFLYRVLPEDSYKVTTGKLHVSLTRLTDGENVVVSEFTSKEELIEALYCSCFVPVYCGLI 161 human
XP_001494853  82 VKKSFLGPLSPSCKMVPMMRQFLYQVLPEDSYKATTGKLHVTLTRLTDGESVVVSEFTSKEELIEALYCSCFVPVYCGLI 161 horse
NP_001092670  82 VKKSFLGPLSPSCKMVQMMRQFLYRVLPEDSYKVTTGKLHVALTRFTDGESVVVSEYTSKEELIEALYCSCFVPVYCGLI 161 cattle
XP_425818     81 ARKTLLGPLSPKCSLLANIRAVLERRLPEDSYLVASGRLHISLTRVVDGQNVMVSEFSSNEELIQALLCSCFLPIYCGFI 160 chicken
XP_001378816 177 VRKYFLGPFSPSCKMVQIMKQFLYRVLPEDSYKMATGKLHVALTRVEDGENVVVSEYTSKEELIEALYCSCFIPVYCGLI 256 gray short-tail...
Feature 1                  #                                                                     
Q8N8W4       162 PPTYRGVRYIDGGFTGMQPCA-FWTDAITISTFSGQQDICPRDCPAIFHDFRMFNCSFQFSLENIARMTHALFPPDLVIL 240 human
XP_001494853 162 PPTYRGVRYIDGGFTGMQPCS-FWTDSITISTFSGQQDICPRDCPAIFQDFRIFNCSFQFSLENIARMTYALFPPDLVVL 240 horse
NP_001092670 162 PPTYRGVRYIDGGFTGMQPCS-FWTDSITISTFTGQQDICPRDCPAIFHDFRMFNCSFQFSLENIARMTHALFPPDLMIL 240 cattle
XP_425818    161 PPSYRGVRYVDGGFTGLQPVSsLEEAVITVSPFTGELDICPRDCPAIFYCFQIFNGSIQISVENLCRISYALFPPSTMVL 240 chicken
XP_001378816 257 PPTYRGERYIDGGFTGMQPCS-YWTDSITISAFSGQQDICPRDCPAIFHDFHLFNCGFQFSLENIARMTHALFPPDLMAL 335 gray short-tail...
Feature 1                                                                                        
Q8N8W4       241 HDYYYRGYEDAVLYLRRLNA---------VYLNSSSKRVIFPRVEVYCqielaLGNECPERSQPSLrarqas------le 305 human
XP_001494853 241 HDYYYRGYEDVVLYLRRLNA---------AHLNSPSKRVIFPRVEVYCqielaLGNECPEHSQPSLqteqas------le 305 horse
NP_001092670 241 HNYYYRGYEDAVLYLRRLNA---------AYLNSPSKRVIFPRVEVYCqielaLGNQCPERCQPSLqrqpas------pe 305 cattle
XP_425818    241 NDIFFQGYQDTALFLCRNNAfgvnyfdgnFRFASMCGKNDFPQPNGMLn---gLGKCVPQYLAPRF-------------- 303 chicken
XP_001378816 336 HEYYYRGYQDTVLYLKRINA---------VYLSSPTKNLIFPRVEVFC-----LGKHLPQGREWKAidgqnsetavatss 401 gray short-tail...
Feature 1                                                                                        
Q8N8W4       306 gatQPHKEWVPKGDGRGSHGPPvsqp----------vqtlEFTCESPVSAPVSPLEQPPAqplasstplsLSGMPPVSFP 375 human
XP_001494853 306 esvQLHTPGAPKEERRGHHGPPvspsvq------tpestwEWAVESPDSPPVSSFEQSPVsplpsspsrpPTDVPPISLP 379 horse
NP_001092670 306 esrQLHTQRAPKEDGRGGRCPPlsppmp------apestcDWPVEPPVLSPASPPASSPSr--------sPTDLPPASLP 371 cattle
XP_425818    304 ---LPDLARWKKQQMFRLQDPL------------------SKVLLQPYKLPAFVWKGLEQlw------glLEDISSMAKQ 356 chicken
XP_001378816 402 kpwRHPLNEATKGNGKDDDDEDlefvlaqlpsssatqpsaEALVPSPPDSPRACLVSSPSe---------QLPLSPALHP 472 gray short-tail...
Feature 1                     
Q8N8W4       376 AVHKPPSSTPGSS 388 human
XP_001494853 380 AVHSPPSSTPGPS 392 horse
NP_001092670 372 AVSSLPSSTPGLS 384 cattle
XP_425818    357 FQKLLRTVVPGLP 369 chicken
XP_001378816 473 MTRSLPALMQSSM 485 gray short-tailed opossum

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap