Conserved Protein Domain Family
Pat_iPLA2

?
cd07218: Pat_iPLA2 
Calcium-independent phospholipase A2; Classified as Group IVA-1 PLA2
Calcium-independent phospholipase A2; otherwise known as Group IVA-1 PLA2. It contains the lipase consensus sequence (Gly-X-Ser-X-Gly);mutagenesis experiments confirm the role of this serine as a nucleophile. Some members of this group show triacylglycerol lipase activity (EC 3:1:1:3). Members include iPLA-1, iPLA-2, and iPLA-3 from Aedes aegypti and show acylglycerol transacylase/lipase activity. Also includes putative iPLA2-eta from Pediculus humanus corporis which shows patatin-like phospholipase activity.
Statistics
?
PSSM-Id: 132857
View PSSM: cd07218
Aligned: 15 rows
Threshold Bit Score: 406.346
Threshold Setting Gi: 56757334
Created: 12-Feb-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Conserved Features/SitesClick to see Conserved Features Help
 
active sitenucleophile
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the crystal structure of semet patatin (1OXW)
  • Comment:catalytic dyad is formed by Ser and Asp
  • Comment:oxyanion hole is formed by two Gly and one Arg

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1               ## #                            #                                        
XP_970721      1 MNLSFAGCGFLGIYHVGVACCFRKYAPHLLLNK--ISGASAGAIAACCLLLDLPLgettsdilRVATEARRRSLGPFNPS 78  red flour beetle
EEB17217       1 MNLSFAGCGFLGVYHIGVACCFKQYAPHLLVDK--IAGASAGAIAACCLLCDLPIggmisdvlRVIRDARKKTLGPFSPS 78  human body louse
XP_001602845   1 MNLSFAGCGFLGIYHVGVAVCFKKYAPHLLLEK--ISGASAGAIAACCLLCDLPLcemtsnllRLAREARQRALGPFSPS 78  jewel wasp
XP_001945398   1 MNISFSGCGFLGIYHIGVASCLKTYAPYLLENK--ICGSSAGAISACCLLCDIPLelmtsqmlDIVRESRSKALGPFSPS 78  pea aphid
XP_002067294   1 MNLSFAGCGFLGIYHVGVAVCLKIYAPHMLQDK--IGGASAGALAACCLLCDLPLatmasdflRIVKEARRHSLGPFSPS 78  Drosophila will...
XP_001355315   5 MNLSFAGCGFLGIYHVGVAVCLKKHAPQLLLER--IGGASAGALAACCLLCDLPIetmaadflRVVGEARRHPLGPFSPW 82  Drosophila pseu...
XP_002166074   1 MNLTFSGAGFLGIYHVGVVSCLKIHGKKFIQNVecYGGSSAGALAACMLLCDMNLkesv-yfvMNLATQARSTLGPLSSS 79  green hydra
XP_002108491   1 MNLSLAGCGFLGLYHLGVVSCLKEHAPQFVNSLrsVSGASAGALSGLVLLVDCPLglitnemmKVVKSIRSSSLGPYNPK 80  Trichoplax adha...
7293031        7 RSLSFSGCGFLGIYHVGVAVCLRQHAPQLLLER--IAGASAGALAACCLICDLPLecmagdflRVVQEIQRHSLGAFSPW 84  fruit fly
XP_001963812   5 TSVSFAGCGFLGIYHVGVAVCLRQHAPQLLLER--IGGASAGALAACCLLCDLPLetmagdflRIVQETRRHSLGAFSPW 82  Drosophila anan...
Feature 1                                                                                      # 
XP_970721     79 FNIHSLLLEGLEKFLPDDAHIRVSGKLHISLTRVHDGKNVIVSQFDSREELIQALLATAFIPIFSGIIPPKFKGVRYMDG 158 red flour beetle
EEB17217      79 FDVQTLLREGLERFLPEDAHIRVSGKLRVSLTRVYDGKNVIVTDFETREELLQALLASAFVPIFSGFIPPKFRGVRYMDG 158 human body louse
XP_001602845  79 FNVQEVLLESLQKFLPEDAHLRVSGKLHISLTRVYDGKNVIVSQYNSREDLLQALLASSFIPLFCGLLPPRFHGIRYMDG 158 jewel wasp
XP_001945398  79 MNITEHLYNRLNKDLPDDAHKRVSGKLFVSLTRVPDGKNVIMSQFSSKEEVIQVLLASAFIPVFSGFVPPLIGKYRYIDG 158 pea aphid
XP_002067294  79 FNIQSCLLEGLQRLLPSDAHERVTGRLHISLTRIWDGKNVIASEFQSRQDLMQALLCSCFIPGFSGILPPRWRGVRYVDG 158 Drosophila will...
XP_001355315  83 FNLQRCLLEGMQRELPEDAHRRVSGRLRISLTRVRDRCNVVMSEFGSRQELLQALLCSCFIPGLSGLIPPQVRGVRYMDG 162 Drosophila pseu...
XP_002166074  80 FDPTTTIRKTFLKYLPENAYKLASEKLFISLTRVSDWKNVVVSNYENNEELVDALICSSFIPFFSGVLPTKYKKEYYIDG 159 green hydra
XP_002108491  81 FNITKTLSALLASFAPDNVHEIVSGRLFISLTRLSDMQNVMISEFHSKNDLIEALCTSSFVPIWSGMTPIIYRGEHYIDG 160 Trichoplax adha...
7293031       85 FNLPECLLEGMRSWLPEDAHLLASGRLHISLTRVSDRRNVVMSEFSSRQELLQALMCSCFIPGLSGLVPPQVRGVRYMDG 164 fruit fly
XP_001963812  83 FNLPDCLLEGMQRRLPDDAHERVSGRLHISLTRVRDRRNVVMSEFASRYELLQALLCSCFIPGLSGLLPPKVRGVRYMDG 162 Drosophila anan...
Feature 1                                                                                        
XP_970721    159 GYSDNLPT-LDENTITVSPFCGESDICPRDDSSQLF--HINIANTSIELSKHNIYRIMRILFPPNPEVLSNMCKQGFDDA 235 red flour beetle
EEB17217     159 GFSDNLPT-LDENTITVSPFCGESDICPRDFSSQLF--HVNVANTSIELSKQNFYRIARILFPPKPETLSKMCKQGFDDA 235 human body louse
XP_001602845 159 GFSDNLPT-LDENTITVSPFCGESDICPRDFSSQLF--HVNLANTSIELSRQNMYRFARILFPPNPEILSNMCKQGFDDA 235 jewel wasp
XP_001945398 159 GFTDNLPI-VDKNTITISPFSGLTDICPRDNPIKKY--LLKISNNSFEMTKTNCFRVARIMFPPEPEMLAKLCYQGFDDA 235 pea aphid
XP_002067294 159 AFSNNLPI-LDGNTVTVSPFSGESDICPRDQSSKLFqiHLNWANTSFQISRRNFHRLIHIILPAHTDFLSSLCHQGFADA 237 Drosophila will...
XP_001355315 163 AFSDNLPL-LDEDTVTVSPFCGESDICPRDRSSHLFhlNINWANTCIRISRPNLRRMLRIVLPGRAEFLSSFCQQGYDDA 241 Drosophila pseu...
XP_002166074 160 GFTDNLPQqFSGITVTVSPFSGESDICPNDDVKCIS--SFDFSNTSVFITAGNIYRMSRALFPPSPDVLSKLCKQGFEDA 237 green hydra
XP_002108491 161 GFSDNQPQpFGQNTILVSPFYGESDICPNDNSMSFH--QFCCNNTNIQVSLSNIYRLSRALFPPEPRVLRSMCQQGYLDA 238 Trichoplax adha...
7293031      165 AFSDNLPL-LDEHTVTVSPFCGESDICPRDQNPHLLqlNINWANTCIRLSRRNLRRMVRILVPGRADFMANFCQQGYDDT 243 fruit fly
XP_001963812 163 AFSDNLPL-LDEHTVTVSPFCGESDICPRDRSPHILqlNLNWANTCIRLSRRNLRRMVRIVLPGRTDFMASFCQQGYDDA 241 Drosophila anan...
Feature 1                  
XP_970721    236 LRFLHRNNLI 245 red flour beetle
EEB17217     236 LKFLQRNNLI 245 human body louse
XP_001602845 236 LRFLNRNNLI 245 jewel wasp
XP_001945398 236 LMFLQKNNLI 245 pea aphid
XP_002067294 238 LEFLHCRNMI 247 Drosophila willistoni
XP_001355315 242 LYFLNRNNLI 251 Drosophila pseudoobscura pseudoobscura
XP_002166074 238 LKYLHLHYNL 247 green hydra
XP_002108491 239 LRFLQNKMAG 248 Trichoplax adhaerens
7293031      244 LQFLRRNSLL 253 fruit fly
XP_001963812 242 LYFLRKNNLL 251 Drosophila ananassae

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap