Conserved Protein Domain Family
Pat_ExoU_VipD_like

?
cd07207: Pat_ExoU_VipD_like 
ExoU and VipD-like proteins; homologus to patatin, cPLA2, and iPLA2
ExoU, a 74-kDa enzyme, is a potent virulence factor of Pseudomonas aeruginosa. One of the pathogenic mechanisms of P. aeruginosa is to induce cytotoxicity by the injection of effector proteins (e.g. ExoU) using the type III secretion (T3S) system. ExoU is homologus to patatin and also has the conserved catalytic residues of mammalian calcium-independent (iPLA2) and cytosolic (cPLA2) PLA2. In vitro, ExoU cytotoxity is blocked by the inhibitor of cytosolic and Ca2-independent phospholipase A2 (cPLA2 and iPLA2) enzymes, suggesting that phospholipase A2 inhibitors may represent a novel mode of treatment for acute P. aeruginosa infections. ExoU requires eukaryotic superoxide dismutase as a cofactor and cleaves phosphatidylcholine and phosphatidylethanolamine in vitro. VipD, a 69-kDa cytosolic protein, belongs to the members of Legionella pneumophila family and is homologus to ExoU from Pseudomonas. Even though VipD shows high sequence similarity with several functional regions of ExoU (e.g. oxyanion hole, active site serine, active site aspartate), it has been shown to have no phospholipase activity. This family includes ExoU from Pseudomonas aeruginosa and VipD of Legionella pneumophila.
Statistics
?
PSSM-Id: 132846
View PSSM: cd07207
Aligned: 32 rows
Threshold Bit Score: 155.13
Threshold Setting Gi: 170744419
Created: 2-Jan-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
active sitenucleophile
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the crystal structure of semet patatin (1OXW)
  • Comment:catalytic dyad is formed by Ser and Asp
  • Comment:oxyanion hole is formed by two Gly and one Arg

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1               ## #                          #                                           
AAC16023      106 SLVLSGGGAKGaAYPGAMLALEEKGMldgirSMSGSSAGGITAALLASGMSPAAFktlsdkmdlislldssnkklklfqh 185  Pseudomonas a...
NP_220907      64 YIAFSGGGAKGaIYSGVYEAAKKTGIldnvkAVAGSSVGAITAAVVALGTPPKRFeeiskntnlqtl------------- 130  Rickettsia pr...
YP_001250164  303 NLVFCGGGAKIfAHVGVWKALNEAGMkp--tKFAGSSAGAIMSLMCYLGYTADEIselfqhfkqe--------------- 365  Legionella pn...
AAX07464       31 GLVLSGGGAKGiSYLGMIQALQERGKiknltHVSGASAGAMTASILAVGMDIKDIkkliegldit--------------- 95   Legionella pn...
YP_126586      26 NLVFRGGGSKGiAYVGALQSLSEQGVlenieNVAGSSAGAMTAAIVACGGSADLMeyfcsansladfvdnrltkkllpks 105  Legionella pn...
YP_008638     473 NLVIKGGGPKGiAYIAVLKKLEEHEAlknleRIAGTSSGAIFASLISVGYTSSEIrdildeidlnkildypddlrldiek 552  Candidatus Pr...
YP_001250989   24 RVVCSGGGAKGvVYPGSYKAMEDTGVfkgveELSGASAGAITSTMLALGMPSAVFrdkllttnlknlmgs---------- 93   Legionella pn...
YP_001773074   12 FVAFAGGGAKGlVHVGALKALETRAVdi--rGVAGTSAGAIVAALKASGFSADDMadpitgrtildelar---------- 79   Methylobacter...
YP_557993       6 RVALSGSGFRLgAHLGALQAIVDAGYev--vELAGTSGGSIVSAMFAGGMKLADMhelcmqmdwspm------------- 70   Burkholderia ...
YP_096418      56 RIVFSGGGSRIlAHIGALDELTRHGLkf--tEFSGSSAGAMVAAFAYLGYNCSEIkqiiswfnedklldsplifnfnnik 133  Legionella pn...
Feature 1                                                                                         
AAC16023      186 iss--------------------------eigaslkkglgnkiggfselllnvlprIDSRAEPLERLLRDETrkavlgqi 239  Pseudomonas a...
NP_220907     131 --------------------------------------------fgkqgfsagmiqLNKDGKPLYDLIELIIkenignfl 166  Rickettsia pr...
YP_001250164  366 ----------------------------------------------hlvqfdidrnGLSDTHSLKTALDYAIankvrqiv 399  Legionella pn...
AAX07464       96 -----------------------------------------------klldnsgvgFRARGDRFRNILDVIYmmqmkkhl 128  Legionella pn...
YP_126586     106 ekslqadssv-----------dyssisheqkgsqldtesslaeaklvtkpskltfaIASKSAKLVEAMEHVMrmaifthf 174  Legionella pn...
YP_008638     553 lkkvlldakeevgliqkkgvsnskfkiafnlifnwvdwwgipcdqkkilkeryasgGLCKGEYLRELIEKKLtekvekhq 632  Candidatus Pr...
YP_001250989   94 -----------------------------------------rigslfgtnppgvsaITRDGKPLEDFIRENIissvktni 132  Legionella pn...
YP_001773074   80 -----------------------------------------idaalstapalfgegGWARVARLRALLRCGLarvavaaa 118  Methylobacter...
YP_557993      71 --------------------------------------------mrfspwavvrhqSLCTGNALQAFLEQSThgktf--- 103  Burkholderia ...
YP_096418     134 qifnk----------------------gglssaklmrqaanyvilkkvmdiisdekFKTRFAKFQNFLEENIyscpenit 191  Legionella pn...
Feature 1                                                                                         
AAC16023      240 athpevarqptvaaia-----------------------------------------------------------srlqs 260  Pseudomonas a...
NP_220907     167 hrsdivnvqndkdldelr-------------------------------------------------------erynqkd 191  Rickettsia pr...
YP_001250164  400 nkykipypkgk--------------------------------------------------------------------- 410  Legionella pn...
AAX07464      129 esvqqpippeqqmnygilkqkialyedklsragivinnvddiinltksvkdlekldkalnsiptelkgakgeqlenprlt 208  Legionella pn...
YP_126586     175 pesldnelnnvheklkaiedkgsaeyinfak------------------------------rqqvledtqkiinelhdpn 224  Legionella pn...
YP_008638     633 gtkinhlt------------------------------------------------------------------------ 640  Candidatus Pr...
YP_001250989  133 asiekietiaasdqtlqdl-----------------------------------------------------laklktkf 159  Legionella pn...
YP_001773074  119 lsvtllllgsflcaamanvaaalilwglwlatcgivfr---------------riraglaglsrlerfkgalgrviaara 183  Methylobacter...
YP_557993         --------------------------------------------------------------------------------      Burkholderia ...
YP_096418     192 fqtla--------------------------------------------------------------------------- 196  Legionella pn...
Feature 1                                                                                         
AAC16023      261 gsgvtfgdldrlsayipqiKTLNITGTAMFEgrpqlv-vfnashTPDLEVAQAAHISGSFPGVFQKvslsdqpy---qag 336  Pseudomonas a...
NP_220907     192 gkiyfkdiallrkydpvqyKDLVITATQQETsalti---fnsfdTPNVEIALACRASASIPIVFKPveid---------- 258  Rickettsia pr...
YP_001250164  411 itfstlaslreqfpdcgigKELIVTATNKRSgktiy---lsanrYPLLEVSEAVKISASFPVLYRDtlld---------- 477  Legionella pn...
AAX07464      209 lgdlgrlrellpeenkhliKNLSVVVTNQTKheler---ysedtTPQQSIAQVVQWSGAHPVLFVPgrna---------- 275  Legionella pn...
YP_126586     225 fdltfghlhtlhqydpqrfKELYVTGTDENGelrif----sheqDADMPVSIAVRVSASLPGVFDPviye---------- 290  Legionella pn...
YP_008638     641 ---fgelrelikteknspfKHLYIVAAKLGPqhgvrifssedpnCDDIIISDAVRASMSIPIVFSPhtlckkvngmriqd 717  Candidatus Pr...
YP_001250989  160 pvitfgdlallnhhfpdkfKQLNMPAVEFPNgaiqv---fnstlTPDVEIALACRASASIPVILKPvtitin-------- 228  Legionella pn...
YP_001773074  184 fpaepdrivrlrdfdgghlLPLKIVGANLSTrqltl---fsaetTPDIAVADAVAASISIPIVFAPqrig---------- 250  Methylobacter...
YP_557993     104 ---------------vdsaIDLKIIAADLLTerefl---fsrqtTPNVPIAMAARASASIPIVFPPvaca---------- 155  Burkholderia ...
YP_096418     197 -------rikeicpecelgEKLFITGTNLSTqkhev---fsidtTPSMALADAIIISANLPIAFERicyq---------- 256  Legionella pn...
Feature 1                #                        
AAC16023      337 vewteFQDGGVMINVPVpemidkNFDSGPLRR 368  Pseudomonas aeruginosa
NP_220907     259 --gkkYVDGGYRDNIPTky---fKDNEPEFCT 285  Rickettsia prowazekii str. Madrid E
YP_001250164  478 --geeHNDGGILSNFPTe----vFFDDHSTLL 503  Legionella pneumophila str. Corby
AAX07464      276 -kgeyIADGGILDNMPEi----eGLDREEVLC 302  Legionella pneumophila
YP_126586     291 --grkYIDGGAANNLPVn----iFFNKEEAYT 316  Legionella pneumophila str. Lens
YP_008638     718 eslgtYVDGGILMNYPIg-----IFDKKKYKR 744  Candidatus Protochlamydia amoebophila UWE25
YP_001250989  229 gvekqFVDGGLYDNLPTd-----YFDLQEDGT 255  Legionella pneumophila str. Corby
YP_001773074  251 --advFVDGGIVSNLPAw-----PFDEERALD 275  Methylobacterium sp. 4-46
YP_557993     156 --galLVDGGTCDNVPAsd--ltVDDVPRLGI 183  Burkholderia xenovorans LB400
YP_096418     257 --gnvYSDGGISNNLPAh-----CFSEKGHKT 281  Legionella pneumophila subsp. pneumophila str. Philadelphia 1

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap