Conserved Protein Domain Family
cPLA2_Fungal_PLB

?
cd07203: cPLA2_Fungal_PLB 
Fungal Phospholipase B-like; cPLA2 GrpIVA homologs; catalytic domain
Fungal phospholipase B are Group IV cPLA2 homologs. Aspergillus PLA2 is Ca-dependent, yet it does not contain a C2 domain. PLB deacylates both sn-1 and sn-2 chains of phospholipids and are abundantly expressed in fungi. It shows lysophospholipase (lysoPL) and transacylase activities. The active site residues from cPLA2 are also conserved in PLB. Like cPLA2, PLB also has a consensus sequence of Sm-X-Nu-Sm (Sm = small residue, X = any residue and Nu = nucleophile). It includes PLB1 from Schizosaccharomyces pombe, PLB2 from Candida glabrata, and PLB3 from Saccharomyces cerevisiae. PLB1, PLB2, and PLB3 show PLB and lysoPL activities; PLB3 is specific for phosphoinositides.
Statistics
?
PSSM-Id: 132842
View PSSM: cd07203
Aligned: 12 rows
Threshold Bit Score: 734.171
Threshold Setting Gi: 68052823
Created: 10-Feb-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:Based on Human Cytosolic Phospholipase A2 structure (1CJY)
  • Comment:catalytic mechanism proceeds through a serine-acyl intermediate using Ser-228 as the nucleophilic residue.
  • Comment:catalytic dyad is formed by Ser and Asp
  • Comment:an oxyanion hole is formed by two Gly residues that polarizes the sn-2 ester
  • Comment:Arg may play a role in substrate stabilization in the cleft

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                     
Q11121     30 PANVSCDEDiNLIRQASG------------PSDNETEWLKKRDVYTREALRSFLDRATsnfsdssl---vsqlfsnaSDI 94  Torulaspora delbru...
Q9P8L1     42 PWQVDCPSNvTWIRNATTg-----------LGTGERAYIEAREKLVQPAIEQMMAARGle---------------tpPRT 95  Cryptococcus neofo...
Q9UVX1    110 PFNLTCPSKkTFIRTASE------------LSQQEKDYIHKRQETTNKNLIDFLSKRAnlsdfdak---sfindnapNHN 174 Candida albicans
P39457     20 PTSVSCPASrPTVRSAAK------------LSTNETSWLEVRRGKTLSALKDFFGHVKvgdydvgay--ldkhsgnsSSL 85  Penicillium chryso...
Q08108     35 PGTVSCPDDiNLVREATS------------ISQNESAWLEKRNKVTSVALKDFLTRATanfsdssevlsklfndgnsENL 102 baker's yeast
Q9P327     70 PFNVTCSND-NLLRPASEg-----------LNEGEQSYINKRISKVNSELRSFISKTGlnvdld--------kvvnsSDG 129 fission yeast
Q9UTH5     39 PFPSTNASYaPVIRSCDSseimvnslprgeLPDLENDFIEKRLSNANEALTTFLQSKNttadld-------lssivgDNG 111 fission yeast
Q8TG06     24 PQNVSCPDNaNFIRNAADg-----------LSPAEKEWLKKRDPITRDALQTFLRRAFanvsteit----salfndtENV 88  Candida glabrata C...
P78854     51 PYYVDCPSDnIVESLSSNe-----------IPSAESEYLSTRSTITNTAMKDFLRNANlpglna--------dtlsgSEG 111 fission yeast
Q9Y7N6     63 PYTVACPSG-SLLRPASDg-----------LSTGEQEFVDKRVSKVNSALESFISKTGlkidtk--------svlndTDG 122 fission yeast
O42790     53 PAVVDCPKTkPTLRKAVD------------LSNEEKNWLSIRRKNTIQPMRDLLKRANitgfdsetf--mneaanniSQL 118 Neurospora crassa ...
Q9UWF6     26 PGPVSCPSS-QLIRSGSQg-----------INPNEQSYINARYPIAKQALSKFLHNANlqnfdv--------dsflaHSN 85  Candida albicans S...
Feature 1              ## #                                      #                            
Q11121     95 PRIAVACSGGGYRAMLSGAGMLAAMDNRTDGANeh-gLGGLLQSTTYLAGLSGGNWLVGTLAWNNWTSVQDIvnnmtedD 173 Torulaspora delbru...
Q9P8L1     96 PVIGVALAGGGYRAMLTGLGGIMGMMNESTEASqs-eTGGWLDGVSYWSGLSGGSWATGSFMSNGGQLPTTLl------E 168 Cryptococcus neofo...
Q9UVX1    175 ITIGLSFSGGGYRAMLAGAGQILGLDGRYEDANkh-gLGGLLDSSTYVVGLSGGNWLVGSLALNDWLSVGDIvn---gkS 250 Candida albicans
P39457     86 PNIGIAVSGGGWRALMNGAGAVKAFDSRTDNATatghLGGLLQSATYISGLSGGSWLLGSIYINNFTTVDKLqth--eaG 163 Penicillium chryso...
Q08108    103 PKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGAYeh-gLGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDIlnnmqndD 181 baker's yeast
Q9P327    130 PRLGIAFSGGGLRAMVNGGGAFNAFDSRFESDSp---LSGLLQSAMYISGLSGGSWLVGSVAINNFTNITYLr------D 200 fission yeast
Q9UTH5    112 PRLGIAVSGGGWRSMLFGGGALAALDSRSNETT----LGGLLQSAHYITGADGGSWLLSSLAVNEFRTIQNIs------K 181 fission yeast
Q8TG06     89 PKLGIAVAGGGYRAMFVGAGAFAAMDNRTDGANeh-gLGGLLQAATYMAGLSGGNWLTGTLAYNNFTSVQQIleegdkaD 167 Candida glabrata C...
P78854    112 PSIGIALSGGGLRAMILGSGALSAMDARHDNHTv---LTGLLQASDYLVGTDGSAWTVGGIALNNFSTINDF-------S 181 fission yeast
Q9Y7N6    123 PRLGIAISGGGFPAMLTGAGAINAFDARNGNTTs---LGGILQSSMYLTGLSGGSWLVGSVAVNNFANITFLh------D 193 fission yeast
O42790    119 PNVAIAISGGGYRALMNGAGFVAAADNRIQNTTgaggIGGLLQSSTYLAGLSGGGWLVGSLFSNNFSSIETLls----eN 194 Neurospora crassa ...
Q9UWF6     86 PTIGLAFSGGGYRAMLTGAGEISSLDSRTKTNTp--vLAGILQASSYIAGLSGGSWLVGSLASNNLNSVDDMl-----sQ 158 Candida albicans S...
Feature 1                                                                                     
Q11121    174 SIWDISNSIINPGGfmi---vtTIKRWDHISDAVEGKQDAGFNVSLTDIWGRALSYNFFPSly--rGGVAYTWSTLRDVE 248 Torulaspora delbru...
Q9P8L1    169 NLWNIDSNLVFPDDg-------KLSFYTNLYTETNAKSDLGFPVQITDIWGLAIGSHVLPEpyqlsNTPNLTFSSLPSVV 241 Cryptococcus neofo...
Q9UVX1    251 TIWQLQDSILNPSGmri---dkTIAYYYGLAQAVQAKEDAGFQTSVTDTWGRALSYQFFEEddsgtGGANITWSSIRNLS 327 Candida albicans
P39457    164 SVWQFGNSIIEGPDaggiqlldSAGYYKDLADAVDGKKKAGFDTTLTDIWGRALSYQMFNAs---nGGLSYTWSSIADTP 240 Penicillium chryso...
Q08108    182 SIWDLSDSIVTPGGini---fkTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSln--rGGIGLTWSSIRDFP 256 baker's yeast
Q9P327    201 NVWNLEHSVFAPHGdnv---ieNLNYYNDLRKEIDQKKHAGFDCSLTDLWGRALSRKLVDAe---rGGPGITYSSMRNQS 274 fission yeast
Q9UTH5    182 SIWYTRLGIFFIEEthf---gdLKNYYTNVVDEVNQKAAAGFNVSLTDYWGRAIARHFVGQl---rGGPNLTYSSVQNAS 255 fission yeast
Q8TG06    168 AIWNITNSFLNPYDkdf---skTLARWTAIGSQVQGKRDAGFNVTITDLWSRALAYGWFPTlp--nAGAGLTWSSLRDNE 242 Candida glabrata C...
P78854    182 KLWAFNHPLMYPKSai----vfNAHFYSSIMNEVAEKANAGFNISLSDYWGRVISRTLGDTt---yGFPNVSLSSITSQE 254 fission yeast
Q9Y7N6    194 DVWNLDHSLFAPYDda----feNFYIYQEWFEQVLQKKNAGFNVSITDLWGRALALKLVNPl---tGGANTTFSSVTNET 266 fission yeast
O42790    195 KVWDFENSIFKGPKeaglstvnRIQYWSEVAKEVAKKKDAGFETSITDYWGRALSYQLIGAd---mGGPAYTFSSIAQTD 271 Neurospora crassa ...
Q9UWF6    159 GLWELTHSFLSYYGieh--pikQVEEWVNVGNQVASKRNANFNVSLTDIYGRLLSYPLLTNte--dEGDAYLWSDVTSAS 234 Candida albicans S...
Feature 1                                                                                     
Q11121    249 VFQ-NGEMPFPISVADGRy----PGTQIIDLNATVFEFNPFEMGSWD-----PTLNAFTDVKYLGTKVSNGEPvnKGQCV 318 Torulaspora delbru...
Q9P8L1    242 AALgNASLPMPIIVAADRkr-reAGELVIAENATVWEFTPYEFGSWAfgsqyKSPGAFTPIEYLGTSVDDGSP--NGTCW 318 Cryptococcus neofo...
Q9UVX1    328 SFQ-DHSMPYPIVVANGRt----PGTYIINENSTIFEISPYELGSWD-----PSLKSFSNIQYLGSSVNNGNPnnTDICV 397 Candida albicans
P39457    241 EFQ-DGDYPMPFVVADGRn----PGELVIGSNSTVYEFNPWEFGTFD-----PTIFGFVPLEYLGSKFEGGSLpsNESCI 310 Penicillium chryso...
Q08108    257 VFQ-NAEMPFPISVADGRy----PGTKVINLNATVFEFNPFEMGSWD-----PSLNSFANVKYLGTNVSNGVPleRGKCT 326 baker's yeast
Q9P327    275 WFQ-NADYPYPIIVADSRl----EEETAIPANTSIFEFTAYEFGTWD-----NGIKAFIPMEYVGTHLLDGVPp-DKSCI 343 fission yeast
Q9UTH5    256 WFQ-TAEYPYPLIVTQGLtgglpDGSNGTATNSSIYEISPYYLTSFD-----NNVRSYTPTQYLGTNYSNGTAv-DGKCV 328 fission yeast
Q8TG06    243 IFM-NGEMPMPISVADGRy----PGTTVINLNATVFEMTPFEIGSWD-----PSLNAFSDIKYLGTQVTDGKPe-TERCI 311 Candida glabrata C...
P78854    255 WYR-NANFPYPIITFATQn----YGEDISNVNTTFFEASPNVFGTFD-----HGINSFIPTEYLGTTLNNGASs-NGSCV 323 fission yeast
Q9Y7N6    267 WFQ-DGEFPFPIIIADNVi----EGETVIPLNDTVFEFTPIEFGTWD-----TGVESFIPMEYTGTHLINGIPl-NESCV 335 fission yeast
O42790    272 NFQ-KAETPFPILVADGRa----PGDTIISLNATNYEFNPFETGSWD-----PTVYGFAPTKYLGANFSNGVIpsGGKCV 341 Neurospora crassa ...
Q9UWF6    235 NFQ-SHQMPFPILISDGRa----PDTTIINLNSTVIELTPYEFGSWD-----PSLNEFVDTRYLGTKLDNGRP--TGKCY 302 Candida albicans S...
Feature 1                                                                                     
Q11121    319 AGYDNTGFIMGTSSSLFNQFLLQINSTslpsfiknl--vtgflddlsEDEDDIAIYAPNPFKDtsy---iqDNFSKSISE 393 Torulaspora delbru...
Q9P8L1    319 KGFDQLSFVMGTSATLFNGAFLELNGTdsglltnl----itafladlGEDQADISRIPNSFSNy-------NSGENPIYN 387 Cryptococcus neofo...
Q9UVX1    398 NNFDNAGFIMGTSSSLFNQILLQLDNYsinsiikmi--lekvltdvsDEEYDIAVYEPNPFFGa------dSAGIKSITT 469 Candida albicans
P39457    311 RGFDSAGFVIGTSSSLFNQFLLQINTTslpsfikdv--fngilfdldKSQNDIASYDPNPFYKy-------NEHSSPYAA 381 Penicillium chryso...
Q08108    327 AGFDNAGFIMGTSSTLFNQFLLRINSThlpsfitrl--arhflkdlsQDFNDIAVYSPNPFKDtkf---ldSDYTTSIVD 401 baker's yeast
Q9P327    344 HNYDNAGFVMGTSATLFNSFLLDWNENvkkndtyyd--ilhailedlSKHQDDIAPYPNPYQNytt---snTSVVNAFEP 418 fission yeast
Q9UTH5    329 TQFDNVGFLVGTSSTRYNEALIDVSLRqsrmsrrl-----gftlrhmRINGSSVSFYPNPYTDatdiagnaTAVSEDIVD 403 fission yeast
Q8TG06    312 NGFDDASFIMGTSSSLFNEFTMSNDSAvaytylntl--sstlvkgidKENNDIAMYAPNPFKGsky---vdSNYTTSIVD 386 Candida glabrata C...
P78854    324 INYDNFGFMMGASSTYFNKIMRNFNDSstkngrii----qqylkgnfSENGQQIISIPNPFQGves---anSDAANNLGS 396 fission yeast
Q9Y7N6    336 RNFDNAGFLMGTSSNVFSGILPATNASltasnntfnn-avlsflemlAEDQLDVGLYPNPYQGygn--asnTTTTNPLEP 412 fission yeast
O42790    342 EGLDQAGFVMGTSSTLFNQFLLANISSydgvpdvlieavtsvlkeigAKRDDVSQIIPNPFLDw-------NNRTNPNAD 414 Neurospora crassa ...
Q9UWF6    303 NGFDNAGFFMGTSSALFNEAVLSITEAnipsflkdii-ddilvdpilKSNIDVSAYNPNPFFKs-------SGSNTAISQ 374 Candida albicans S...
Feature 1            #                                                                        
Q11121    394 SDYLYLVDGGEDNQNIPLVPLvqDERNVDVIFALDNSADTdy-yWPDGASLVSTYERQFSSQGl----NMSFPYVPDkRT 468 Torulaspora delbru...
Q9P8L1    388 LTYITLVDAGETNQNIPLEPLlvPTRDVDAIVAFDSSYDSdy-iWPNGTALRTTYERAKILAEhe-ntRVLMPEVPSmNG 465 Cryptococcus neofo...
Q9UVX1    470 NDTLYLCDGGEDLQNVPFYPLiqNKRGVDVIFAFDNSADTns-sWPNGTSIQETYKRQFSKQGk----GTPFPFAPDyKT 544 Candida albicans
P39457    382 QKLLDVVDGGEDGQNVPLHPLiqPERHVDVIFAVDSSADTdy-fWPNGTSLVATYERSLNSSGia--nGTAFPAVPDqNT 458 Penicillium chryso...
Q08108    402 SDSLFLVDGGEDDENVPVLPLiqKERDVDIIFAVDNSADMrl-aWPDGSSLVHTYERQFVKQGq----GMSFPYVPDtNT 476 baker's yeast
Q9P327    419 YDTIDLVDGGEDRENIPLWPLlhPQRFVDVVFAIDSTYNDpy-gWPLGSSIVATYERVVTFNAnksvdVRGFPYIPDeNT 497 fission yeast
Q9UTH5    404 TPYLDLFDGGYDGQNIPIWPLlqPERKLDVVFAFDSSGDTsn-fWPNGSSLVATYERVTQRASdavydVEDFVHVPTpET 482 fission yeast
Q8TG06    387 SDSLFLVDGGEDLQGIPFVPLlkQERDLDIIFAIDVDTETsd-nYPAGGPMMKTYERQFSKQGk----GMAFPYVPDmTT 461 Candida glabrata C...
P78854    397 SSSLNLVDTFLTGEKIPLWPLlqKGRDVDVIVAVDNGDDSew-lWPNGNSLVQTYERVVAAQAagntnVKGFPYVPSqQS 475 fission yeast
Q9Y7N6    413 YPIIELIDGGSDSEGIPFWPLlhPQRDVDVIFAIDGGYQSatsgWPDGSSLVSTYERVLATNSs---gVRGFPYIPDtNT 489 fission yeast
O42790    415 TLELDLVDGGEDLQNIPLNPLtqPVRAVDVIFAVDSSADVt--nWPNGTALRATYERTFGSISn----GTLFPSIPDdWT 488 Neurospora crassa ...
Q9UWF6    375 SKNLYLVDGGEDGQNIPISPL--LHRNVSAIFAFDNSNDVl--nWPDGTSLVKTYERQFSSQGn----GIAFPYVPDqYT 446 Candida albicans S...
Feature 1                                                                                     
Q11121    469 FVNLGLADKPSFFGCDAQNltdl----------nyiPPLVVYIPNARHSYnSNTSTFKLSYTDDERLKMIKNGFEAATRg 538 Torulaspora delbru...
Q9P8L1    466 FVNGGYNSRPTFFGCNDTT-----------------TPVIIYIPSYPWSFaANTSTYQLSYENNEANEMLLNGMRSLTLn 528 Cryptococcus neofo...
Q9UVX1    545 FLDKNMGDKPVFFGCNSSDledlvawhendkinvtdVPLVVYTSNTRMSYnSNFSTFKLSYSDQEKFGAIRNGFETVTRn 624 Candida albicans
P39457    459 FINLGLSTRPSFFGCDSSNqt-------------gpSPLVVYIPNAPYSYhSNISTFQLSTDDAERDNIILNGYEVATMa 525 Penicillium chryso...
Q08108    477 FVNLGLNKKPTFFGCDANNltdl----------qyiPPLVVYLPNAEYSFnSNQSAFKLSYSESQRRSMIQNGFEIATRn 546 baker's yeast
Q9P327    498 IISLGLNTRPTFFGCDGKNttagnh-----dvdnntPPLLVYFPNYPWTYySNISTFTMSMDDKMANGILENAFMSTTQ- 571 fission yeast
Q9UTH5    483 FVNLGLNANPTFFGCDGRNttrgdv-----pvdhntPPLVVYMPNTPWTMkSNLVDHRYRIANSEIQALIQNGFVATTQ- 556 fission yeast
Q8TG06    462 FVNLGLGGKPSFYGCDANNltdl----------eyiPPLIVYIPNSYHSFeSNVSTFKLNYNYSERVGMIRNAFEATTRn 531 Candida glabrata C...
P78854    476 FVSLHFNDRPVFFGCDGRNttagnh-----tvtrdtPPLVIYLPNVPYNYfTNISTDRTYYTEDMIQQLLTNGLISSTV- 549 fission yeast
Q9Y7N6    490 FLALGLNTHPTFFGCDGRNttagnh-----tvnddtPPLVVYFPNYPWTMyANVTTYTVQLEDTLSSGMIENAAVAATQ- 563 fission yeast
O42790    489 FINLGLNNRPSFFGCDVKNftlna--------nqkvPPLIVYVPNAPYTAlSNVSTFDPSYTMSQRNDIIGNGWNSATQg 560 Neurospora crassa ...
Q9UWF6    447 FRNLNLTSKPTFFGCDAKNltslt-------kdiydVPLVIYLANRPFTYwSNTSTFKLTYDDNERQGMISNGFEIATRs 519 Candida albicans S...
Feature 1                                                      
Q11121    539 nlTDDSSFMGCVACAVMRRKQQSLNATLPEECSTCFTNYCWNGTIDDTP 587 Torulaspora delbrueckii
Q9P8L1    529 --HSVPTWPTCFACALTDRSFMYTSENRSTTCQECFDTWCWAGDDNTTE 575 Cryptococcus neoformans var. neoformans B-3501A
Q9UVX1    625 nlTDDENWSTCVGCAIIRRQQERLGEEQSDECKKCFQEYCWTGGFKDAA 673 Candida albicans
P39457    526 nsTLDDNWTACVACAILSRSFERTGTTLPDICSQCFDRYCWNGTVNSTR 574 Penicillium chrysogenum
Q08108    547 nfTDDPEFMGCVGCAIIRRKQQALNITLPPECETCFKNYCWNGTLDTTP 595 baker's yeast
Q9P327    572 --NNNESFAVCLACAIIQRSLERKKLSTPTQCSSCFQEYCWDGTLATST 618 fission yeast
Q9UTH5    557 --DNSTDFASCLACAVVQRSLERRNQSTSAACQQCFSQYCWNGTVDNTP 603 fission yeast
Q8TG06    532 nlTEDADYVTCVGCAIIRRKQQSLNLTLPDICDKCFTNYCWNGTIDNTP 580 Candida glabrata CBS 138
P78854    550 --DNDTYFGQCFACAVVKRTLERNNITASPECQQCYYNYCWSGLYDDSA 596 fission yeast
Q9Y7N6    564 --NNSDSFAVCVACALVQRSLERKNMSTPSQCASCFNQYCWNGTIASTT 610 fission yeast
O42790    561 ngTLDSEWPTCVACAVISRSLDRLGRQTPAACKTCFERYCWNGTVNSKD 609 Neurospora crassa OR74A
Q9UWF6    520 sgSLDDEWAACVGCAIIRREQERQGIEQTEQCKRCFENYCWDGTIYKGE 568 Candida albicans SC5314

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap