Conserved Protein Domain Family
cPLA2_Grp-IVC

?
cd07202: cPLA2_Grp-IVC 
Group IVC cytoplasmic phospholipase A2; catalytic domain; Ca-independent
Group IVC cPLA2, a small 61 kDa protein, is a single domain alpha/beta hydrolase. It lacks a C2 domain; therefore, it has no Ca-dependence. Group IVC cPLA2 is also referred to as cPLA2-gamma. The cPLA2-gamma enzyme is predominantly found in cardiac and skeletal muscles, and to a lesser extent in the brain. Human cPLA2-gamma is approximately 30% identical to cPLA2-alpha. The catalytic domain of cytosolic phospholipase A2 (PLA2; EC 3.1.1.4) hydrolyzes the sn-2-acyl ester bond of phospholipids to release arachidonic acid. At the active site, cPLA2 contains a serine nucleophile through which the catalytic mechanism is initiated. The active site is partially covered by a solvent-accessible flexible lid. cPLA2 displays interfacial activation as it exists in both "closed lid" and "open lid" forms. Movement of the cPLA2 lid possibly exposes a greater hydrophobic surface and the active site. cPLA2 belongs to the alpha-beta hydrolase family which is identified by a characteristic nucleophile elbow with a consensus sequence of Sm-X-Nu-Sm (Sm = small residue, X = any residue and Nu = nucleophile). Includes PLA2G4C protein from human and Pla2g4c protein from mouse.
Statistics
?
PSSM-Id: 132841
View PSSM: cd07202
Aligned: 6 rows
Threshold Bit Score: 703.853
Threshold Setting Gi: 55925353
Created: 10-Feb-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:Based on Human Cytosolic Phospholipase A2 structure (1CJY)
  • Comment:catalytic mechanism proceeds through a serine-acyl intermediate using Ser-228 as the nucleophilic residue.
  • Comment:catalytic dyad is formed by Ser and Asp
  • Comment:an oxyanion hole is formed by two Gly residues that polarizes the sn-2 ester
  • Comment:Arg may play a role in substrate stabilization in the cleft

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                          ## #                           
Q9UP65          4 SEVSIIPGLQKEEKAAVERRRLHVLKALKKLRI--EADEAPVVAVLGSGGGLRAHIACLGVLSEMKEQGLLDAVTYLAGV 81   human
NP_001007431    9 SEVRIAHSLNRNEEQFVVKRRKDVLQSLARLGIrcSQDKVPNIALLGSGGGQRAMVGLLGCLDQLDKAGLLDCVLYLSGV 88   zebrafish
XP_001379604   62 PKIIIHPGISDKEKKSVDNRQKRILGMLQKLDI--KTSKAPVVAVLGSGGGLRAAIACQGVLGELNHVGILDLTTYLAGV 139  gray short-ta...
XP_001379646  585 SDIHIRSGISEEEKAAVKKRKELVLTTLRNLGL--NANKAPVVSVLVSGGGLRAAIACQGILSELSNVGLLDLVTYLAGV 662  gray short-ta...
XP_001920985    9 SEVRIEPSLNKSEQEFVARRRISVLQSLQKLSTpcNQENVPNIALLGSGGGQRAMVGLLGCLDQLDKAGLLDCVLYLSGV 88   zebrafish
AAI29975       15 SGVCPATRLQEAEKAAVHKRSPKVLEALRKLNI--QADQAPVIAVLGSGGGLRAHIACLGVLSELKELGLLDAVTYLAGV 92   house mouse
Feature 1         #                                                                               
Q9UP65         82 SGSTWAISSLYTNDG---DMEALEADLKHR---FTRQEWDLAKSLQKTIQAAr-sENYSLTDFWAYMVISKQTRELPESH 154  human
NP_001007431   89 SGSTWCMASLYQEPDwstKLQTVKDRIFRRi-gGPAVSWSDAYAKMKEYYSEk--DYFTLTDVWAVLVVTTFVKEIDEST 165  zebrafish
XP_001379604  140 SGSTWCMSSLYVRKNwqdHLAEAEEELKVR---LQEGSWNPGTALKGIQEAArrsENFSLTDIWQYTLVYYMTKELLGSS 216  gray short-ta...
XP_001379646  663 SGSTWCMSSLYTKSDgwqNLQKAENELRRR---LQKDKWNFSHALTGLCMAAk-rDDYSLTDFWSYTLVYFLTKELLDAN 738  gray short-ta...
XP_001920985   89 SGSTWCMAALYQEPDwstKLQTVKDRIFSRisgPAVSLKDKFAKLKKYFKGK---DHFSLTDVWAVLAVTTFVKEIDEHT 165  zebrafish
AAI29975       93 SGSTWALSSLYTKNG---NMEGIEEELKHR---YEKNEWDFHESLEKAIQASk-rENYSLTDFWAYLIVSRQIRELQDSN 165  house mouse
Feature 1                                                                                         
Q9UP65        155 LSNMKKPVeeGTLPYPIFAAIDNdlqpsWQEARAPETWFEFTPHHAGFPA-----LGAFVSITHFGSKFKKGRLVRTHPE 229  human
NP_001007431  166 PSDQREQH--KKDPFPIFTVIDKq----CKQSGDGDPWFEITPRETGYSL-----TGAFVSSPSFCSQFENGRKVKRQPE 234  zebrafish
XP_001379604  217 LSEVRTRSeeGEVPYPIFAAIDNsllseWNEKKSLETWFEFTPHVAGYPL-----PGAYVRTTHFGSKFNGGKLIKKEKE 291  gray short-ta...
XP_001379646  739 LSGSRSQSetGTVPYPIFATVDHyf-krKGKEKTLKSWFEFTPHEAGYPKldlstPGAYVSTTLYGSKFKAGKLIQQEAE 817  gray short-ta...
XP_001920985  166 LTDQHGHN--NKDPFPIYTVIDKt----CKQRNNGDPWFEITPYEAGYSL-----SGAFVNASTFGSQFHQGSRKSQQNE 234  zebrafish
AAI29975      166 LSSLKKQVeeGVLPYPIFAAIDEdlladWRERKTQNSWFEFTPHHAGYPA-----LGAYVPITEFGSRFENGKLVKSEPE 240  house mouse
Feature 1                                                                                         
Q9UP65        230 RDLTFLRGLWGSALGNTEVIREYIfdqlrnltlkglwrravanaksighlifarllrlqessqgehpppedeg------- 302  human
NP_001007431  235 VDMLYLQALCGSALADGIEIAKFLwekikeffrhllrvmieemeredpmfgpiqkcsqvlleladmnicvlngqnptald 314  zebrafish
XP_001379604  292 KDFAYLRALWGSALADKETTQRTIqqfiwsflsqqdikkvsmsatyecsdehdaesymlslkdsadmqspvpilrlyvlq 371  gray short-ta...
XP_001379646  818 RDLSYLRGLFGSALADRNSILTSIrgdilktimeelvtlvyifttggdylpvleslhfkmagykdfsqsqrmi------- 890  gray short-ta...
XP_001920985  235 FDMLYLQALCGSALADELEIMKMLwqkikefcfhlfklpeinvfpfkdsnsasvdkcyqml------------------- 295  zebrafish
AAI29975      241 RDLTFLRGLWGSAFADIKEIKNYIlnyfrnpfgklkfiegpvtyseaprmnvdamlldlvmayftdmndpsikdklcalq 320  house mouse
Feature 1                                                                                         
Q9UP65        303 ------------------------gepehtwltemlenwtrtslekqeqphedperkgslsnlmdfvkktgiCASKWEWG 358  human
NP_001007431  315 rsiri------klkelsggkrqfifqveklivpdkrdarlnmnqytldvctylqslqlewpvdismwmrinvCMALWIWG 388  zebrafish
XP_001379604  372 kfalpsvslklkcifrfetfptpssrkhfeidfvgseklssledehedrseqsfslremygsfsfgmlsvlqSLFTWTWG 451  gray short-ta...
XP_001379646  891 -----------------------tkmlqhsrqtssdqqrqsildlltevlkhdakeernirpfvqfiwktfkCLLFWTWG 947  gray short-ta...
XP_001920985  296 ------------------------------------mnlvdmnlavlngkdpsaldesiraklndawmyictCMDLWIWG 339  zebrafish
AAI29975      321 qalgtetdefgiemaeiiqnwnetsaekkeqfldhlldrfkktqedtttyslmnwntglvwdrcvfvnetrkCVSKWQWG 400  house mouse
Feature 1                                      #                                                  
Q9UP65        359 TTHNFLYKHGGIRDKi---MSSRKHLHLVDAGLAINTPFPLVLPPTREVHLILSFDFSAGDPFeTIRATTDYCRRHKIPF 435  human
NP_001007431  389 RNYNFLHNMTDRAIPp--aQRTSDTRDYEDAGLLLNSPYLSVLRKERNTDLIISLDFSEGDPFmTVRGAAETCRKLNIPF 466  zebrafish
XP_001379604  452 STNNFLYQHEGLKDKpldgMESKEKLHLMDAGLAINSPYPLVLPPVRNTQLILSFDFSEGDPFeTIKTTAEYCSAHGIPF 531  gray short-ta...
XP_001379646  948 TTNNFLYKYGDIKDKd---LTDRENLYLMDAGLDINCAYPLVLPPVRDTDIILSFDFSEGDPFlTIKDTAKYCKACNIPF 1024 gray short-ta...
XP_001920985  340 RNYNFLHDITDEAVPs--tLPKGDTRDYIDAGLLLNSPYFSVLRKERNVDLIISLDFSEGDPFlTVKDAAEMCRKQNIPF 417  zebrafish
AAI29975      401 TVYNFLYKHGKIADEt---MCSRELLHLVDAGFAINTPYPLVLPPVRETHLILSFDFSAGDPLeTIRATADYCQRHEIPF 477  house mouse
Feature 1                                                                                         
Q9UP65        436 PQVEEaeLDLWSKAPASCYILKGETGPVVMHFPLFNIDAcggdi-----------------------------eawsDTY 486  human
NP_001007431  467 PQVKI--PDQDIKKPKDFYVFKGKNTPTVIHIPLFNVVN--------------------------------------CGD 506  zebrafish
XP_001379604  532 PELDVakLNQEAEAPSDFYIFEGKEGPVVMHFPLFNKVN--------------------------------------CGK 573  gray short-ta...
XP_001379646 1025 PPVDEdkLDQDAEAPSDFYIFEREKGPVVMHFPLFNKVNcgspgpedlrvirgakqenalpreetpdfldnlfcraaCPL 1104 gray short-ta...
XP_001920985  418 PQVRI--PDQDIEKPKDFYVFKGQNTPTVIHIPLFNVVN--------------------------------------CGD 457  zebrafish
AAI29975      478 PEVSEdqLKEWAKAPASCYVLRGETGPVVMHFTLFNKDN--------------------------------------CGD 519  house mouse
Feature 1                                                             
Q9UP65        487 DTFKLADT---------YTLDVVVLLLALAKKNVReNKKKILRELMNVAGLY 529  human
NP_001007431  507 QLEDWRNE---------YTTNQRAYSTQKITDLMTvAGKNISNNKGRLMQQI 549  zebrafish
XP_001379604  574 NISNMAKTyktf-qlgnYSQEDVHQLLELSKANVKnNKEKIMEKIRALAKEA 624  gray short-tailed opossum
XP_001379646 1105 QVIKKRREtfatfrfddYSDDEVRQLLEDAKANAW-SAHNLRSDHRGTESQR 1155 gray short-tailed opossum
XP_001920985  458 KLEDWRKKyrtf--qgaYSTEMITDLMNVAGINISnCKEKLMKEISAAIGQK 507  zebrafish
AAI29975      520 DIETWRKKygtvklsdsYTPDLVRDLLRVSKENVKkNKINILSEMRKVAGNP 571  house mouse

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap