Conserved Protein Domain Family
cPLA2_Grp-IVB-IVD-IVE-IVF

?
cd07201: cPLA2_Grp-IVB-IVD-IVE-IVF 
Group IVB, IVD, IVE, and IVF cytosolic phospholipase A2; catalytic domain; Ca-dependent
Group IVB, IVD, IVE, and IVF cPLA2 consists of two domains: the regulatory C2 domain and alpha/beta hydrolase PLA2 domain. Group IVB, IVD, IVE, and IVF cPLA2 are also referred to as cPLA2-beta, -delta, -epsilon, and -zeta respectively. cPLA2-beta is approximately 30% identical to cPLA2-alpha and it shows low enzymatic activity compared to cPLA2alpha. cPLA2-beta hydrolyzes palmitic acid from 1-[14C]palmitoyl-2-arachidonoyl-PC and arachidonic acid from 1-palmitoyl-2[14C]arachidonoyl-PC, but not from 1-O-alkyl-2[3H]arachidonoyl-PC. cPLA2-delta, -epsilon, and -zeta are approximately 45-50% identical to cPLA2-beta and 31-37% identical to cPLA2-alpha. It's possible that cPLA2-beta, -delta, -epsilon, and -zeta may have arisen by gene duplication from an ancestral gene. The catalytic domain of cytosolic phospholipase A2 (PLA2; EC 3.1.1.4) hydrolyzes the sn-2-acyl ester bond of phospholipids to release arachidonic acid. At the active site, cPLA2 contains a serine nucleophile through which the catalytic mechanism is initiated. The active site is partially covered by a solvent-accessible flexible lid. cPLA2 displays interfacial activation as it exists in both "closed lid" and "open lid" forms. Movement of the cPLA2 lid possibly exposes a greater hydrophobic surface and the active site. cPLA2 belongs to the alpha-beta hydrolase family which is identified by a characteristic nucleophile elbow with a consensus sequence of Sm-X-Nu-Sm (Sm = small residue, X = any residue and Nu = nucleophile). Calcium is required for cPLA2 to bind with membranes or phospholipids. The calcium-dependent phospholipid binding domain resides in the N-terminal region of cPLA2; it is homologous to the C2 domain superfamily which is not included in this hierarchy. It includes PLA2G4B, PLA2G4D, PLA2G4E, and PLA2G4F from humans.
Statistics
?
PSSM-Id: 132840
View PSSM: cd07201
Aligned: 11 rows
Threshold Bit Score: 916.726
Threshold Setting Gi: 189530897
Created: 9-Feb-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:Based on Human Cytosolic Phospholipase A2 structure (1CJY)
  • Comment:catalytic mechanism proceeds through a serine-acyl intermediate using Ser-228 as the nucleophilic residue.
  • Comment:catalytic dyad is formed by Ser and Asp
  • Comment:an oxyanion hole is formed by two Gly residues that polarizes the sn-2 ester
  • Comment:Arg may play a role in substrate stabilization in the cleft

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                     ## #               
Q86XP0       269 LKAEGCPEELAVHLGFNLCAEEQAFLSRRKQVVAKALKQALQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKL 348 human
P0C869       243 LKKEAGLRELAVRLGFGPCAEEQAFLSRRKQVVAAALRQALQLDGDLQEDEIPVVAIMATGGGIRAMTSLYGQLAGLKEL 322 human
XP_426428    301 LKAEESTWDLDVRLGFDLCKGEREFVDKRKKRVSEALKKILNLKQLPQRDEVPVVAVLGSGGGMRALTSFYGSLAGLQQL 380 chicken
XP_426427    265 AKANEWPRNLDARLGFGLCMDEQNFLQNRRKVVAAALKDVLHLEEDLQDHEVPIVAVTTAGCGIRALTGMYGSMLGLQKL 344 chicken
Q3MJ16       290 GESLGSPETLDVRLGFSLCPAELEFLQKRKVVVAKALKQVLQLEEDLQEDEVPLIAIMATGGGTRSMTSMYGHLLGLQKL 369 human
XP_421150    261 LKTKQCQEDLDVRLGFDLCEQEKDFICKRKKVVAAALKDILQLEEDLEDDEVPVVAIMTTGGGTRALTAMYAHLLSVQEL 340 chicken
XP_001234838 294 LTSRKCSGDLDVRLGYSLCREEQDFLRKRKKYVAAALKKILNLEEDLKEHEVPVVAITTTGGGTRSLTAMYGSLLGLQKL 373 chicken
Q68DD2       303 MKVEMSSGDLDLRLGFDLSDGEQEFLDRRKQVVSKALQQVLGLSEALDSGQVPVVAVLGSGGGTRAMSSLYGSLAGLQEL 382 human
XP_421153    313 VKEEDGSKNLDLRLGFDLCAEEKDFICKRKKVVAAALKNVLQLDEDLQEDEVPVVAVMTTAGGVRSMTSMFGSLLALQEL 392 chicken
XP_001234824 280 VKSVDWSRNLDVRLEFDLCMEEKNFLQKRRKLVASALKKALNLEQDLQDHEVPVVAVMTTGGGTRALTSLLGNLLGLQKL 359 chicken
XP_001920867 238 KTDDRSDEEMDVRLDFDIPEEEKRFLAKRRKVVSQALQKALNLSSAPDPSKVPLVAVVCSGGGSRALTSTYGSLKGLQNI 317 zebrafish
Feature 1                    #                                                                   
Q86XP0       349 GLLDCVTYFSGISGSTWTMAHLYGDPEWSQRDLEGPIRYAREHLAKSKLe-VFSPERLASYRRELELRAEQGHPTTFVDL 427 human
P0C869       323 GLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPTELLKTQVTKNKLg-VLAPSQLQRYRQELAERARLGYPSCFTNL 401 human
XP_426428    381 GLLDAAMYLSGISGSTWCLSTLYQDPNWSQKDLRDAINRAQRAVSSSKGg-AFSPERLKYYFQELSAMESSGRKVSFTDL 459 chicken
XP_426427    345 RVLDCVSYISGSSGTTWTMTKLYEDAEWSHKDIGEIIIEARKQAAKCKMg-AFCLRSLRNYYKELSQRTQAGHKTSFIDL 423 chicken
Q3MJ16       370 NLLDCASYITGLSGATWTMATLYRDPDWSSKNLEPAIFEARRHVVKDKLp-SLFPDQLRKFQEELRQRSQEGYRVTFTDF 448 human
XP_421150    341 NVLDCVSYVTGLSGTTWTMANLYEDPDWSQKNLKKALDDIRRHVLKNKFvaCFAPDRLKYYLKELCQRKQEGHQISFTDL 420 chicken
XP_001234838 374 NLLDCISYIGGLSGTTWTMANLYEDAGWSEKYLEEAIKEARKQVTKNKIc-CFSLDCLKYYYNDLMERVKEGRNTSFIDL 452 chicken
Q68DD2       383 GLLDTVTYLSGVSGSTWCISTLYRDPAWSQVALQGPIERAQVHVCSSKMg-ALSTERLQYYTQELGVRERSGHSVSLIDL 461 human
XP_421153    393 GVLDCISYISGLSATTWTMAKLYEDANWSQKDLRGPIDDIRKYVIKSKLh-CFSTDHLKYYEKELCERKLEGHKLSFTDL 471 chicken
XP_001234824 360 GLLDAISYITGSSGSTWTLAHLYQSPDWSHKDISGQIREVRRHMTKSKLs-CFSLESLKYYDRELKLRKQEGYQISSIDF 438 chicken
XP_001920867 318 QILDTVSYITGVSGATWALASIYEEPNWSKGDIDKTMESVKKELSKTIFs-LFSSEQLQRYKEKIDEREKQGHIVSLIDM 396 zebrafish
Feature 1                                                                                        
Q86XP0       428 WALVLESMLHGQVMDQKLSGQRAALerGQNPLPLYLSLNVKenNLETLDFKEWVEFSPYEVGFLKYGAFVPPELFGSEFF 507 human
P0C869       402 WALINEALLHDEPHDHKLSDQREALshGQNPLPIYCALNTKgqSLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEFF 481 human
XP_426428    460 WGLIVEYFLQQKVDPSKLSDQQEAVkwAQNPYPIYAAVNVRp-NISSGDFAEWCEFTPYEVGFRKYGAFVRTEDFDSEFF 538 chicken
XP_426427    424 WGLMIESMLNDGKCYHRLSDQRRAVnhGQNPLPIYLALNVKd-KVTTKDFREWVEFTPYEVGFLKYGAFIRAEDFGSEFF 502 chicken
Q3MJ16       449 WGLLIETCLGDERNECKLSDQRAALscGQNPLPIYLTINVKd-DVSNQDFREWFEFSPYEVGLQKYGAFIPSELFGSEFF 527 human
XP_421150    421 WGLIIESMFRDKEDSQKLTDQQQALnrGQNPLPIYLSLNVKd-KISDQDFREWVEFTPYEVGFLKYSAYISAEDFGSEFF 499 chicken
XP_001234838 453 WGLVIESMLHDKKDEHRLSDQRQAVdnGQNPLPIYVAINLKs-NYSAQAFREWLEFTPYEVSLLKYGASIRVEHFGSEFF 531 chicken
Q68DD2       462 WGLLVEYLLYQEENPAKLSDQQEAVrqGQNPYPIYTSVNVRt-NLSGEDFAEWCEFTPYEVGFPKYGAYVPTELFGSELF 540 human
XP_421153    472 WGLFIDSMLHNEENTHKLSDQQLAVnqGQNPLPIYLSLNVRd-KFSTLDFKEWVEFTPYEVGALKYGAFVRSEDFGSEFF 550 chicken
XP_001234824 439 WGLLLERALSDGKNNHKLSDERWALtqGQNPLPIYMILNIKd-DYSLSEFKEWVEFTPYEVGFLKYGAFIRAEDFGSKFF 517 chicken
XP_001920867 397 WGLALEYLFRGKKHMGTLSELQRTVseGQNPLPIFTSVNIKngRTESIEDAEWCEFTPYEVGFPKYGAFIPAQNFGSEYY 476 zebrafish
Feature 1                                                                                        
Q86XP0       508 MGRLMRRIPEPRICFLEAIWSNIFSLNLLDAWydltssgeswkqHIKDKTRSLEKEPlttsgtssrleas---wlqpgta 584 human
P0C869       482 MGQLMKRLPESRICFLEGIWSNLYAANLQDSLywasepsqfwdrWVRNQANLDKEQVpllkieepps---------tagr 552 human
XP_426428    539 MGRLIQKRPEPRICFLQGMWGSAFAASLDDIClkvvgvglsfldPFKDVIKVIDDCRrfhfrdptrlktr---livpggp 615 chicken
XP_426427    503 MGRLMKKLPESRICFMQGMWSSIFSKNLLDAWhaadnsedfwhrWTQDKVTEIEEQPdlpekpyematcm----ftptsg 578 chicken
Q3MJ16       528 MGRLVKRIPESRICYMLGLWSSIFSLNLLDAWnlshtseeffhrWTREKVQDIEDEPilpeipkcdanilettvvipgsw 607 human
XP_421150    500 MGRLMKKIPESRICFLEGIWSSVFSLNLLDAWyisvhsedfwhkWTRDKITDIDDETlfpkrpneletrv----vcptds 575 chicken
XP_001234838 532 MGRLVKKLPETRICYMQGMWSSIFSIDVMYVWnlaadsedfwfrWTRDRVKDIEEEPflsmnpyevdtcl----ltpsst 607 chicken
Q68DD2       541 MGRLLQLQPEPRICYLQGMWGSAFATSLDEIFlktagsglsfleWYRGSVNITDDCQkpqlhnpsrlrtr---lltpqgp 617 human
XP_421153    551 MGHLMKKIPESRICFLEGTWSNIFSQSFMDVVylsghsedfwhrWTRGTEHDIEEHPalptrpheqttcl----slpkgy 626 chicken
XP_001234824 518 MGRLMKKLPESRICFMKGLWSNVFSYNLLDAWhssdpsdrcslrCTQPTAVDVEGDEpsppvrnnelety---ivtpecg 594 chicken
XP_001920867 477 LGHMIKKLPETALSILVGMWSSIFSVNLTNIWsiatg---aapsWTPQVEGGKSNTEtskptaltthli------npvtd 547 zebrafish
Feature 1                                                                       #                
Q86XP0       585 laqafkGFLTGRPLHQRSPNFLQGLQLHQDYCShkdfstwa-dyqldsmPSQLTPKEPRLCLVDAAYFINT-SSPSMfRP 662 human
P0C869       553 iaefftDLLTWRPLAQATHNFLRGLHFHKDYFQhphfstwk-attldglPNQLTPSEPHLCLLDVGYLINTsCLPLL-QP 630 human
XP_426428    616 llqifqDFFKSRVTCGETFNFMHGLYLHKDYVKikefvvwr-gthldafPNQLSPMEENLYLVDGGFSINS-PFPLVlQP 693 chicken
XP_426427    579 lsttlrDILTDRPAVSKYHNFLRGFQMHNEYIQheqfakwk-dtlldtsPNDLRGHSEHLELVDAAFFFETsCPPLM-RP 656 chicken
Q3MJ16       608 lsnsfrEILTHRSFVSEFHNFLSGLQLHTNYLQngqfsrwk-dtvldgfPNQLTESANHLCLLDTAFFVNSsYPPLL-RP 685 human
XP_421150    576 fsdifrDVVTLRPAASEIRNFLKGLQMNNNYLEsefskwk--dceldsqPNHLTGAADYLILIDTAFVFATsYPPLM-RP 652 chicken
XP_001234838 608 fssvlrDVLTGRPTIAQYPNFIRGLQMHSKYLEsdgfstwkdtvidcfpNKLMETANDELSLVDTGFFINTsYPPLL-RS 686 chicken
Q68DD2       618 fsqavlDIFTSRFTSAQSFNFTRGLCLHKDYVAgrefvawk-dthpdafPNQLTPMRDCLYLVDGGFAINS-PFPLAlLP 695 human
XP_421153    627 lsnalrEMMTGRPVVSYYHNFIKGLQLHNKYLEnesfcmwk-dtvldssPNQLNAMGDYLKLVDTAFFINTsCPPFL-RP 704 chicken
XP_001234824 595 imgivrEVLTERVMVSKFFNFLKGFQMHNEYLQsksfciwk-dtvlenfPNQLTETAEFLCLADTAGYIDIsYPPLM-RP 672 chicken
XP_001920867 548 fakmlcGFMTSRPIVSQMFNFLRGFNLHRNYQEntgfiawk-ekhpdafPNTMTPSDPVLSLVDAGFALNAgFPPIV-RS 625 zebrafish
Feature 1                                                                                        
Q86XP0       663 GRRLDLILSFDYSl-SAPFEALQQTELYCRARGLPFPRVEPSpQDQHQPRECHLFSDPacPEAPILLHFPLVNASFKDHS 741 human
P0C869       631 TRDVDLILSLDYNl-HGAFQQLQLLGRFCQEQGIPFPPISPSpEEQLQPRECHTFSDPtcPGAPAVLHFPLVSDSFREYS 709 human
XP_426428    694 ERDVDVILSFNFSw-EAPFEVLELTQQYCEEREIPFPKIEVSeEDEKKPKECYVFLDDdnPKAPIVLHFPLVNDTFQKYK 772 chicken
XP_426427    657 ERKVDVIIHLNYTg-GSQTLPLKQACSYFSEQGIPFPKFGLK-DDEKNLKECYMFNGAdnPGAPLLLYFPLVNDTFQRYV 734 chicken
Q3MJ16       686 ERKADLIIHLNYCa-GSQTKPLKQTCEYCTVQNIPFPKYELP-DENENLKECYLMENPqePDAPIVTFFPLINDTFRKYK 763 human
XP_421150    653 ERKVDVILHFNYSs-GSQTRPLKEASNYFAKQGIPFPKEVPDdQETPQLKECYIVGEKesPETPIVIFFPLVNDTFREYK 731 chicken
XP_001234838 687 KREVDVILHLNYSg-GSQTLPLDQIAKYISGQGIPFPKIEISdEDRENLKECYVFEDAdsPQVPTVLFFPLVNDTFKNYK 765 chicken
Q68DD2       696 QRAVDLILSFDYSl-EAPFEVLKMTEKYCLDRGIPFPSIEVGpEDVEEARECYLFAKAedPRSPIVLHFPLVNRTFRTHL 774 human
XP_421153    705 ERKVDVILHLNYSg-GSQTLPLDLFSEYCLEQGIPFPCTELScEDREHLKECYVFEDN--LEAPILVYFPLVCDTFQRYK 781 chicken
XP_001234824 673 ERKVDVVLHLNYSs-GSQTSPLEEASKYFSKQGIPFPKIRLSeEEKKNLKECYIFEDAetPEAPTVVFFPLVNDTFRKYK 751 chicken
XP_001920867 626 HRNVDVILSINYSweLDQFKVVKQAQEYCTDRKIPFPKIDFKkLESEPLREVYVFEDKnnPDAPIVLHFPLVNVSFKQFK 705 zebrafish
Feature 1                                                                                 
Q86XP0       742 APGVQRSPAELQGgqvdl---tgatCPYTLSNMTYKEEDFERLLRLSDYNVQTSQGAILQALRTALKHRTLEA 811 human
P0C869       710 APGVRRTPEEAAAgevnl---sssdSPYHYTKVTYSQEDVDKLLHLTHYNVCNNQEQLLEALRQAVQRRRQRR 779 human
XP_426428    773 GPGVKRESEDEKSfgdfv--ietkdSPYRTLNFTFEPYDFSRLVEVNRYNVLNSSDTLLKTLNLALQRRKLKN 843 chicken
XP_426427    735 APGMSRSAAEMEQgkvdl---ssfsSPYSTREVSLKAEDFNKLQKLTTYNIMNNENVILQALRMAVARKKQAL 804 chicken
Q3MJ16       764 APGVERSPEELEQgqvdi---ygpkTPYATKELTYTEATFDKLVKLSEYNILNNKDTLLQALRLAVEKKKRLK 833 human
XP_421150    732 APGVRRSPSEMAEgdvdv---anscGPYYINNLSYSEEDFDKLVNLSYYNVQNNKDLILQALRAAVERKKQQK 801 chicken
XP_001234838 766 APGVERSPEELAEgkvdv---csilSPFTTREVCFSEENFDKLVKLTDYNVLNNEKLIIQALRMAVARRKQRN 835 chicken
Q68DD2       775 APGVERQTAEEKAfgdfv--inrpdTPYGMMNFTYEPQDFYRLVALSRYNVLNNVETLKCALQLALDRHQARE 845 human
XP_421153    782 APNVERSPAEMEKgrvdv---sncfAPYGTGQLTYTEGNFNKLLNLCNYNILNNKRLILQALKTAVERKKRFK 851 chicken
XP_001234824 752 EPGVERSSAEMAQgnvdv---sglfSPYCINSFTYTEEQFDNLVKLTSYNIQNNKHLILQALNSAIEQKRQHK 821 chicken
XP_001920867 706 APGVKREGEKELKegavdvdfnsntSPYATHKLTYTPEDFQRLINLTSYNIQNNKDVILNALNKALNRNRDKR 778 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap